KEGG   Malus domestica (apple): 103414046Help
Entry
103414046         CDS       T03194                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00052  Galactose metabolism
mdm00500  Starch and sucrose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103414046
   00500 Starch and sucrose metabolism
    103414046
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103414046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103414046
NCBI-ProteinID: XP_017181892
LinkDB All DBs
Position
12
AA seq 431 aa AA seqDB search
MDRRLHLPFFFFFLSVFYLASSAKAIAEAEAAVGYGYRILSVNYYBSSRNSLTANLGLIK
PSSLXGPDIPNLNLHASCETKDRLRIRITDSKQQRWEIPQNMIPXQTKTPTPTPHCISSS
DFVFTLRNTTPFGFTITRRSSNDVIFDTSPKSSDPNTXLVFKDQYIQLSSSLPQNRSSIF
GLGEHTKSSFKIIPNQTLTLWNADIGSVNPDLNLYGSHPFYLDVRSASQDGGKTGAGTSH
GVLLLNSNGMDITYSGARITYKVIGGIVDLYFFSGPTPELVVEQYTELIGRPTPMPYWSF
GKXHQCRYGYKNVSDVEGVVAGYAKASIPLEVMWTDIDYMDAYKDFTLDPVNFPLDRMKK
FVNTLHQNGQKYVLILDPGISNNDTYETYIRGKKADIFIKRNGIPYLEVYGLWWDLHPMV
VVHEHIYKHFV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcgtctgcatctgccattcttcttcttcttcttgtctgttttctatcttgca
tcatctgcaaaagcaattgcagaagcagaagcagcagttgggtatggatacagaattcta
tctgtcaactactacrattcctccaggaactcattgacygctaatcttggcctcatcaag
ccctcctccctcwacggacctgacatcccaaatctcaatcttcacgccagctgtgaaacc
aaagatcgtctaagaattcgaattacagactcaaagcaacaacgatgggaaatcccacaa
aacatgattcccmrtcaaaccaaaacgcccacccccaccccccactgcatctcctccagc
gactttgtcttcactcttcgcaacaccaccccattcggcttcactatcacccgccgctcc
tccaacgacgtcatcttcgacacctcccccaaatcatcagaccccaacacctwcttggtc
ttcaaggaccaatacatccaactctcctcttctctcccccaaaacagatcctccattttc
ggcctcggcgagcacaccaagtcctccttcaagatcattcccaaccaaacattgactctc
tggaatgctgacattggtagcgtcaatcccgacctcaacctttacgggtcccaccctttc
tacctggacgtcaggtcsgcgtctcaagatggcggcaagaccggtgcaggaacatctcat
ggggtgttgctgctgaatagtaatggcatggacataacatacagcggtgctaggattact
tataaggtaattggtggaattgtggacttgtacttyttttctggaccgacrcctgagttg
gtggtagagcaatatacagaactcattggtcgccctacccctatgccctactggtctttt
ggtaagwttcaccagtgtcgatatggttacaagaatgtttccgatgttgagggcgtggtt
gctggttatgcaaaagccagtatccctcttgaagttatgtggacggacattgattacatg
gatgcttacaaggacttcactctcgatcccgtcaactttccattggataggatgaagaaa
tttgttaacactcttcaccaaaatggtcagaaatatgtcctcatcttggatcctggtatc
agtaacaatgatacctatgaaacctacatcagagggaagaaagcagatatattcatcaag
cgcaatggaattccttacctggaagtgtatggcctgtggtgggatctccatccaatggtg
gtggttcatgaacatatctataaacattttgtatga

DBGET integrated database retrieval system