KEGG   Malus domestica (apple): 103418327Help
Entry
103418327         CDS       T03194                                 

Definition
(RefSeq) protein TIC110, chloroplastic
Organism
mdm  Malus domestica (apple)
SSDB OrthologParalogGFIT
Motif
Pfam: Tic110 D5_N Not1
Motif
Other DBs
NCBI-GeneID: 103418327
NCBI-ProteinID: XP_008354678
LinkDB All DBs
Position
3
AA seq 1004 aa AA seqDB search
MNPSTLTPHRSALRSPFLNPISLPAATSVHSRRRRFRVSFPRNSAASSEQPTDASPPPPD
VFGGKRELTGIQPVVEKLSPPLRIVTSAIVFAGAVAAGYGLGLRLGKSQNAAYGGAAVLG
AAGGAALYAMNSCAPEVAAVDLHNYVAGFDDPKAVKKEDIEGIARKYGVSKQDEAFNAEL
CDLYCRFVTSVLPPGAQELKGDEVDTIVSFKNSLGIDDPEAASMHMEIGRRIFRQRLETD
REGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVELAIRDNAQRLYASKLK
SVGRDIGVEQLVKLKEAQRMYRLSDEHAEDLFKEHARKLVEANISAALRILKSRTRSAAG
ITEVVEELDKMLELNSLLISLKNQPDAARFAPGVGPVSLLGGDYDADRKMDDLKLLFRAY
VTDSLSTGRLEESKLSALNQLRNIFGLGKREAESIVLDVTSKVYRKCLSQSVASGELEAA
DSKAAFLQNICEELHFDPQRASQIHEEIYRQKLQQCVADGELNEDDVAALLRLRVMLCIP
QQTVEAAHSDICGSLFEKVVKDAIASGVDGYDADVKQAVRKAAHGLRLSREAAMSIAGKA
VRKIFINYVKRARSVGSRTESAKELKKMIAFNTLVVTELVADIKGESSDSATEEPIKEPE
TEVLEDEEWESIQTLRKIRPDKELAAKLGKPGQTEITLKDDLEERERTDLYKTYLLFCIT
GEVKKIPFGAQITTKKDDSEYVLLNQLGAILGLSTTEIVEVHRSLAEQAFRQQAEVILAD
GQLTKARVEQLNELQKQVGLPPQYVEKIIKNITTTKMAAAIETAIGQGRLNIKQIRELKE
SSVNLDSMISESLRESLFKKTVDEIFSLGTGEFDEEEVYEKIPADLNINAEKTKNVVREL
AQTRLSNSLIQAVSLLRQRNRQGVVSSLNDLLACDKAVPAKPLSWEVPEELADLFGIYMK
SDAAPEKLSRLQYLLGISDSMATALLEMGDRLQTIGAEEEKFVF
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctccactctcactccccaccgctccgctctccgctcgcccttcctcaacccc
atctctctccccgccgcaacctccgtacactcccgacgacgccgtttcagggtctcattt
ccccggaattctgccgcctcctcggaacaaccaacagatgcgtcaccgccgcctcccgat
gtcttcggcggcaagagagagctcaccggtatccagcccgttgtggagaagctttcgccg
ccgctccggatagtgacgtcggcaattgtgttcgctggagctgtggctgcgggttatggg
ttgggtctccgattggggaagtcccaaaatgcagcttatggcggtgcagcggtgctcgga
gccgccggtggggccgccttatacgctatgaactcttgtgctcccgaggtcgccgcggtt
gacttgcacaattacgttgccgggttcgacgacccgaaagctgttaagaaggaggacatt
gaaggcattgcgagaaaatatggtgtgagcaagcaagacgaggcgtttaatgccgagctc
tgtgatttgtactgtcgttttgtcacttctgttcttcctcctggagctcaagaactcaaa
ggcgacgaagtcgacacaatcgtcagcttcaagaattctctgggaatcgatgaccccgaa
gcagcttcaatgcatatggagattggaaggcgaattttcagacagcgacttgagactgac
cgtgagggtgatctagagcagcgtcgggcgtttcagaagctgatttatgtttcgactctt
gtgtttggggatgcttcatctttcctcttaccttggaagcgtgtttttaaagttactgat
tcccaggttgagctggctatccgtgataatgcccagcgtttatacgcttccaagttaaaa
tccgttggcagagatattggagtagagcagcttgttaagcttaaagaagcacaacgcatg
tatcggctctctgacgagcacgcagaggacttgttcaaggaacatgcaagaaaactagtt
gaggcaaatatttcagcagcacttcgtatactcaagtccagaaccagatcagctgctgga
atcacagaagttgtggaagagctcgataaaatgctagaactcaatagtttgctcatctca
ctaaagaaccagccagatgcagctcgctttgcacctggggttggcccagtttctttactt
ggtggcgactacgatgctgatagaaagatggacgacttgaagctcctcttcagagcatat
gttacggattctttatccacaggtcgcttggaagagagtaagctttcggccttgaatcag
ttaaggaatatatttggtttgggcaaacgagaggcagaatccattgtgcttgatgttact
tcgaaggtataccgtaaatgtctttcacaatctgttgcatcgggtgagttagaagctgca
gacagcaaagcagccttccttcaaaatatctgtgaggagctgcattttgatccacaaaga
gccagccagattcatgaagaaatttaccggcaaaagcttcagcagtgtgttgctgatgga
gagctgaatgaggatgatgttgctgcattgttaaggctacgggtcatgctttgtatacct
cagcagacggttgaggctgcccattcagatatctgtggcagtttgtttgaaaaggttgtg
aaggacgcaattgcatctggtgttgatggttacgacgctgatgtaaaacaagccgtgaga
aaggcagctcatggtctgcgattgtctagggaggctgccatgtctattgctggcaaggca
gtaagaaagatttttattaactatgtaaaacgagcacggtcagttggtagccgtactgag
tctgcaaaagaacttaaaaagatgatagctttcaacacattggttgtgactgaattggtg
gcagacataaaaggggaatcatctgattccgccacagaagagccaataaaggagccagag
acagaagtcctggaggatgaggaatgggaatctattcagacacttcgaaagattagaccc
gacaaggagcttgctgcaaagttggggaagcctggccagactgagataactcttaaagat
gatctggaagaaagagagaggactgacctatacaaaacatacttgctgttttgtataact
ggggaagtgaagaagattccctttggtgctcagatcactacaaagaaggatgattcagaa
tatgtgctactaaatcagcttggggcgatattgggtttaagcactacggagatagttgaa
gtacacaggagcctggccgagcaagctttcaggcaacaggcagaggtgattttagctgat
ggacaattgacaaaagccagggtagagcaacttaatgaattgcagaagcaagttggcttg
cctccacagtacgtggaaaagataataaagaatataactactacaaaaatggcagctgcg
attgaaaccgctattggtcaggggaggctcaatattaagcagataagagaacttaaagaa
tcaagtgttaatttagacagcatgatatctgagagcttgcgagaaagtctgttcaaaaag
accgtggatgagatattctcattaggcaccggagagtttgatgaggaagaagtctatgag
aaaatcccagcagatctcaatattaatgctgagaagaccaagaatgttgttcgagagctt
gcacagaccagattatcaaactcactgattcaggctgtgtcacttctgaggcagagaaat
cgtcaaggagtggtttcctctcttaatgacttgctagcttgcgacaaagctgtgcctgcc
aagccactttcatgggaagttccagaggagctggccgatctctttggcatatacatgaaa
agcgacgcggcaccagagaaattatcgcgcttgcagtatctcttgggcattagtgacagc
atggccactgctctcctggagatgggagatagattacaaaccatcggtgcggaggaggaa
aagtttgtattctga

DBGET integrated database retrieval system