KEGG   Malus domestica (apple): 103423359Help
Entry
103423359         CDS       T03194                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mdm  Malus domestica (apple)
Pathway
mdm03030  DNA replication
mdm03410  Base excision repair
mdm03420  Nucleotide excision repair
mdm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103423359
   03410 Base excision repair
    103423359
   03420 Nucleotide excision repair
    103423359
   03430 Mismatch repair
    103423359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mdm03032]
    103423359
   03400 DNA repair and recombination proteins [BR:mdm03400]
    103423359
Enzymes [BR:mdm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103423359
    6.5.1.6  DNA ligase (ATP or NAD+)
     103423359
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103423359
DNA replication proteins [BR:mdm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103423359
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103423359
DNA repair and recombination proteins [BR:mdm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103423359
   NER (nucleotide excision repair)
    Other NER factors
     103423359
   MMR (mismatch exicision repair)
    Other MMR factors
     103423359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103423359
NCBI-ProteinID: XP_008359654
LinkDB All DBs
Position
3
AA seq 796 aa AA seqDB search
MLSRSLCSCHCLLLPSLRRLHXPISLFRPKPSSLPLISLLPQNPNLRAMSSRPSAFDALM
SGARAAAAKKKPQPSPSKKRKALDSTXPIKKPQLLPTPESACATQDPESVEVKAPESKEI
KEAQESSGNGGEVVPAGKXVCVAAGAKERTEELKSRMPLLKKKAGEFDPKLVANWGQGER
VPFVFVCLVFDLIDKETGRIVITDIVCNMLRTVMYTTPEDLVPVIYLAANRIAPAHEGLE
LGIGDASIVKALAEACGRTEAHVKKQYKELGDLGHVAKESRSSQSMMRKPDALTVTKVFS
TFRLLAKESGKDSQEKKKNHIKALLVAATDCEPLYLIRLLQTKLRIGLAEQTLLTALGQA
AVYTEKHSTPPSHIQSPLEEAAKIVKQVYSLLPDYDKIIPALLSGGVWXLPEICNFTLGV
PVGPMLAKPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHFMENGSVEIYSRNAERNTGKY
PDVVAAVSRLKKSSVTSFVLDCEIVAYDREKQKILPFQVLSTRARKNVSVSEIKVEVCIF
AFDMLYLNGQPLIQEQLKVRRECLYDSFVEEAGFFQFATALTSNDIDEIQKFLDAAVSSS
SEGLIIKTLTKDATYEPSKRSLNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGAF
LLACYDSNNEEFQSICKVGTGLTEAMLEERSASLRTKVIPKPKSYYRYHDTMNPDVWFEP
SEVWEVKAADLTISPVHRAAVGIVDANKGISLRFPRLIRVREDKPPEQATSSEQVAELYN
AQAINHSNNQNDNEDD
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctctcacgatcactctgttcatgccattgtctacttctcccctctctccgccgtctc
cacasccccatctccctcttccgccctaaaccctcttctcttcctctcatttccctctta
ccccaaaaccctaatcttcgcgccatgtcctcccgcccctccgccttcgacgccctcatg
tcyggygcccgcgccgccgccgccaagaaaaagccccagccttctccctccaagaagcgc
aaagccctagactccactkaccctatcaaaaaaccccaattgctgcctacgcccgaaagc
gcctgcgcaacccaagacccagaatccgtggaagtcaaagctccggaatccaaggaaatt
aaagaagctcaagaaagttctggcaatggcggtgaggtggttccggcagggaagamagtg
tgcgtggcggcgggtgctaaggagcggactgaggaattgaagagccgaatgccgctactg
aagaagaaagccggggaatttgacccaaaattggtggcgaattggggccagggcgagagg
gttccttttgtgtttgtttgtttagttttcgatttgattgacaaagagacgggtcgratt
gtgatcacggatattgtttgtaacatgttgaggactgtaatgtacaccacgcctgaggat
ttggtgcctgtgatttatcttgcggcgaataggattgctcctgcgcatgaaggtttggag
cttggaattggggatgcttcgattgttaaggcccttgcagaggcttgtgggaggactgaa
gcgcatgtgaagaagcaatacaaggagctgggagatcttggtcatgttgcaaaggaaagc
cgttcttctcaatctatgatgcgcaagcctgatgcattaactgtcaccaaggtttttagt
acatttcgtctactagctaaggaatctgggaaggatagtcaggagaagaaaaagaaccat
atcaaggcacttcttgttgctgccactgactgtgaacctctatatctgatccgtttgctt
cagacaaagttgcgaattggattggcagagcagactctattaactgcattgggacaagct
gcagtgtatactgaaaaacattcgacaccaccttctcatattcagagtcctctagaagag
gcagcaaagattgttaagcaagtgtactctctgcttcctgattacgataaaatcatccct
gcccttttaagtggaggtgtatggaakcttccagagatatgcaactttactttgggcgtc
ccagttgggcctatgctagcaaaaccaactaaaggggtatctgagattgtacagaagttt
caggatacagaatacacgtgtgaatacaagtacgatggagaacgtgcccagatacatttc
atggagaatggttctgttgagatatacagtcgaaatgctgaacgaaacactggaaagtat
cctgatgtggttgctgcagtgtcgaggttaaagaagtcatctgtaacatcattcgttttg
gattgtgaaattgttgcttatgaccgtgaaaaacaaaaaattctgcccttccaggtactc
agcactagagcgcgtaaaaatgtgagcgtgagtgagatcaaggttgaagtctgcatattt
gcttttgatatgttgtaccttaatggccaaccacttattcaggaacaactgaaagttcgt
agagagtgtctgtatgactcttttgtggaagaagctgggttttttcagtttgccacagcc
ttaacatcaaatgatattgatgaaatacaaaagtttcttgatgctgctgtcagttcragt
tctgagggtttaattattaaaacattgaccaaagatgctacttaygagccttcaaagcgg
tcacttaactggctgaaattgaagaaagattacatggacagtattggggactcactagac
ttggtacctattgctgctttccatggccggggaaaacgtacaggtgtctatggtgctttc
ctcctcgcttgttatgatagcaataatgaagagtttcaaagcatttgtaaagtaggcact
ggactcactgaagcaatgcttgaagaacgttctgccagtctccgtactaaagtgataccc
aaacctaagtcatactataggtatcatgatacaatgaatccagatgtatggtttgaaccc
tcagaggtttgggaggtgaaagctgcggacctgactattagccccgttcatcgtgctgca
gttggcatagtggatgctaataagggtatttctctccggtttccacgtcttattcgagtt
cgggaagacaaacctccggagcaagccacatcatctgagcaggtagccgagttgtataat
gctcaagcgatcaaccattcaaacaatcaaaatgacaacgaagatgattag

DBGET integrated database retrieval system