KEGG   Malus domestica (apple): 103423752Help
Entry
103423752         CDS       T03194                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00010  Glycolysis / Gluconeogenesis
mdm00020  Citrate cycle (TCA cycle)
mdm00620  Pyruvate metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01200  Carbon metabolism
Module
mdm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103423752
   00020 Citrate cycle (TCA cycle)
    103423752
   00620 Pyruvate metabolism
    103423752
Enzymes [BR:mdm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103423752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 103423752
NCBI-ProteinID: XP_008360055
LinkDB All DBs
Position
13
AA seq 475 aa AA seqDB search
MASSPFLSKTTISFSSSISTALPWRXSPSSSSSSTAFRSIPRRRTLTVQSKIREIFMPAL
SSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVG
AAIGLLAETEEEVAEAREKAKSTSSSSSPAVTPTPPPATATPAPAIAQPAPSATPTYTAK
KGVATPFAKKLAKQHKVEIASVVGTGPFGRITPADVEAAAGIVKPAKPVAAEPTPVAAAP
PKPSAAAPPLLPGSTVVPFTTMQXAVSKNMVESLSVPTFRVGYPINSDAIDALYEKVKPK
GVTMTALLAKAAAMALAQHPVVNASCKDGKSFSYNSSINIAVAVAINGGLITPVLQDADK
LDLYLLSQKWKELVEKARSKQLQPHEYTTGTFTLSNLGMFGVDRFDAILPPGQGAIMAVG
ASKPTVVADTDGFFSVKSKMLVNVTADHRIVYGADLAAFLKTFAKIVENPESLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtctcctttcctctccaagaccaccatttccttctcctcctccatctccaca
gctctcccatggcgcmcctccccctcctcytcctcctcttccactgcattccgctccatt
cctcgccgccgcaccctcaccgtccaatccaagatcagggagatcttcatgcctgctctc
agctccactatgaccgagggaaagatcgtctcctgggtcaaatccgagggcgacgtcctc
tccaaaggcgagagcgtcgttgtcgtcgagtctgacaaagccgacatggacgtagagaca
ttctacgacgggattctcgccgcaatcgtcgtcggggaaggcgagaccgctcccgtcggc
gccgccatcgggcttctcgctgagaccgaagaggaagtcgccgaggccagggaaaaggcc
aaatccacatcgtcttcttcatccccagctgttacgcccacgcctcctcctgctaccgcc
actcccgcccctgcaattgcccagcctgctccatctgctactcctacttacactgccaaa
aagggcgtggccactccttttgctaagaagctagccaagcagcacaaggtcgaaattgcc
tccgtggtgggcaccggcccatttggccgaattacgcctgctgacgtggaggcagccgcc
ggaattgtaaagcctgctaaacccgtcgccgccgagcccactccggtggccgctgctcca
cccaagccttctgctgcagccccgcctctgcttcccggctcaaccgtggtgccatttacc
acgatgcaggytgctgtttcgaagaacatggtcgaaagtctctcggtgccgactttccgg
gtcggctacccgattaacagtgacgccatcgacgccctttatgagaaggtgaaaccaaag
ggtgtgacaatgactgcattgttggccaaggcwgctgctatggcacttgctcagcacccg
gttgtgaatgcgagctgcaaagacgggaagagcttttcgtataacagcagcataaacatt
gctgttgctgtggcaatcaatggaggactcataacccctgttcttcaggatgctgataag
ttggatttgtatttgctatcccagaaatggaaagagttagtggagaaggcccgttcaaag
caacttcagccccacgaatacacaacaggaactttcaccttgtccaatttgggcatgttt
ggagtggacaggtttgatgctattcttccaccagggcagggggctatcatggctgttgga
gcttcaaagccaactgttgtcgctgatacagatggattcttcagtgtaaaaagtaaaatg
ctggtgaatgtaactgctgatcaccggattgtwtatggtgctgatttggctgccttcctc
aagacatttgcaaagattgttgagaacccagagagcctcacattgtag

DBGET integrated database retrieval system