KEGG   Malus domestica (apple): 103423952Help
Entry
103423952         CDS       T03194                                 

Definition
(RefSeq) FIP1[V]-like protein isoform X1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
mdm  Malus domestica (apple)
Pathway
mdm03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    103423952
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mdm03019]
    103423952
Messenger RNA biogenesis [BR:mdm03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     103423952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 103423952
NCBI-ProteinID: XP_008360247
LinkDB All DBs
Position
13
AA seq 1140 aa AA seqDB search
MEDFDDDFGDLYAGVEAQASLAINGVADFAHFYTEDVSDDNGKAKNASPGSDSKKPDSVC
EELGEKVSALEEDEDFNGSDSEDDLKIVLNDEDCEGKVFPNGGRGRVKNDEHEDEGDDGF
PPTKEYKYHDNSMCYQHKGSSSQISGIRDPPNRMVAQNRYGFRLPWYRTILDVNIESFEE
KPWKYPGVDVTDYFNFGLNEDCWKQYCISLEQLWLTSMQFGIPVSKASKFYQAKEAGSAY
EKFSQETIYKETNNAGPTKFAPPPSRDSDSSFRELELPKGRAIQVEDSMVERQPSFDSRH
PRSLDSDVVIQIAVQDGTEETSNSGEEQGHTNLTAHEASDNGELTANGNQIIPAEEDDLL
VGTPEGNTRRSDRCSPRISATCPMKIDSDQRNNQVVALDGYDQIQGNAVSLETTEIANKT
RDGVGKDTLYADQCLMEAQLSFGDDDQLSPTSSCFGSDSEASKNGVHFDPEDIHTPVTSS
FENSKSNGIKRTIVDIKNYSTRNSHAQKEHKHQKRRLHSVVEPKIHIKDDDDDDASLTSE
MEDLYDRDSSLNYSRQKKILRDFGCSDREDISDYKESRRYADNHVHTAKTNYVDRKGNHK
IQDKLDPFFRKNWNEREYFCEDRDRDWHRFGRARFSKERSPLSSRESRGWHSSYSPHTVE
ERDAQFRRNAKKLQFQKIPIHGGGRFGYKREDDFVGEKFRKCASFTDQRTNNLDEFDERQ
FPRLRRELQHSRGRGGYVDSPNFDWDDSWSEKIENEYCRHGENQYLFDQSYKESYAGDEG
RWIDSLSPRIDVSHTRATDERYWRHARETYSAEFKESNWFDNRYNADEIDDIIYPSDQFK
WRRSNQRSEVLHWTEDQLTVRCRGDKLYSEKSSLSYQKFVRHDKFHAKYGSYNDAMHVDM
LSEQDRLELMRKGSSANCINSSSKMYIGKHERTALRCRGSIDLVVGEGKVQLGEPKSVRS
HKRGSLIRNGMLENMDPEFGGEQTTLADCSQYEKVRAVQFNTQKVGRNQNNTKGLDKFPV
ENGDLDAEAGQTLTEDLKTAHPLQGKHASEYSSAAQNVNRRTFCGEIGSSGDKVAEGYDN
QRILATKAKMEKRGERFKEPITLKKEPDKLSKPEIDLVETAEAQLHRPSRKRRWGGIEAV
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttcgacgatgatttcggggatttgtatgcaggcgttgaagcgcaggccagt
ttggccatcaatggcgtagcagacttcgctcacttttacacagaagatgtaagtgatgat
aatggaaaggcgaaaaacgctagtcctggctccgattcgaagaagcccgattctgtctgc
gaggagttgggtgagaaagtttcggctttggaggaggatgaggacttcaatggaagtgat
agcgaggatgacctgaaaatagtgctgaatgatgaggactgtgagggcaaagtgtttcca
aatggcggccgagggagagtgaagaatgatgagcatgaggatgagggtgatgatggtttt
ccgcctacgaaagagtataagtaccatgataatagtatgtgctatcaacacaaggggtcg
agctctcagattagtggtattcgtgatccccctaatcgaatggtggctcaaaatagatat
ggtttcagacttccttggtataggaccatacttgatgtaaacattgaatcatttgaggag
aagccatggaagtatcctggagttgatgtaacagattatttcaatttcggtttgaacgag
gactgttggaaacagtactgcatctccctggaacaactatggctaacatctatgcagttt
gggatccctgtctcaaaagcgtcaaaattttatcaggctaaagaagctggatctgcgtat
gagaaattctcccaggaaactatttataaagaaacgaacaatgctggaccaacaaagttt
gctccgcctccatctagagattctgattccagtttcagagagttggaactaccaaaagga
agagcaattcaggttgaagatagtatggttgaacgccaaccatcttttgatagtaggcat
ccacgtagtttggattctgatgttgtgatacagattgcggtgcaggatggcactgaggaa
acctcaaactctggtgaggaacagggccatacaaatcttactgcacatgaggcatctgat
aatggagaattaactgcaaatggcaaccaaattattcctgccgaagaagatgatttattg
gtaggaactccggaagggaacacaagaagatcagacaggtgttccccgaggatcagtgcc
acttgtccaatgaaaatagattctgatcaaagaaataaccaggtcgttgctctggatggg
tatgaccaaattcaggggaatgctgtctcattggagactactgaaattgcaaataaaaca
agggacggtgttggcaaggatactttgtatgctgatcaatgcctgatggaggcacaatta
tcatttggtgatgacgatcaacttagccccacttcatcctgttttggaagtgattctgaa
gcatcaaagaatggtgttcattttgatccagaagatattcatactcctgtcacatcatct
tttgagaactcgaaaagcaatggcatcaagagaacaatagttgatataaaaaattattcc
acacgtaatagtcatgctcaaaaggagcataagcatcagaaaaggaggcttcacagtgtt
gtcgaaccaaagattcacattaaagatgatgatgatgatgatgcttccctcacctcggaa
atggaggacctttatgacagggatagctcattgaattatagcagacagaaaaaaattctg
cgagattttggctgtagtgatagagaagatatttcagattataaagaatctcggagatat
gccgacaaccatgttcataccgctaaaacaaattatgtggatagaaaaggtaatcacaag
atccaagacaagctagatccatttttcagaaaaaactggaatgaaagggagtatttttgt
gaagatagggatagagattggcatcgttttggaagagcacgattctctaaggagaggagt
cctctctcgagcagggagtccagggggtggcattccagttattccccacacactgttgaa
gaaagggatgctcaatttagaaggaatgccaagaaactgcagtttcagaaaatacccatc
catggtggtggccgtttcggttataaacgtgaagatgactttgtgggagaaaaatttagg
aaatgtgcttcattcactgatcaaagaacgaataatttggatgaatttgatgaaaggcag
tttcctcggctcaggagagaattacaacactccaggggaaggggtggatatgttgacagt
cccaattttgattgggatgattcatggtctgagaaaattgaaaatgaatattgcagacat
ggagaaaatcaatatttgttcgatcagtcttacaaagaatcatacgcaggggatgaagga
aggtggattgattccctatcaccaagaattgatgtttctcacacaagagcaactgatgaa
agatattggagacatgctagagaaacatactctgctgaattcaaagaaagtaattggttt
gataatcgttataatgctgatgaaattgatgacatcatttatccgagtgatcaatttaag
tggagaagatctaaccagcgatctgaagtcctacactggactgaggatcagttaactgtc
aggtgccgtggtgataaattgtattctgagaagtcatccctttcatatcagaaatttgta
agacatgacaaatttcatgctaaatatggttcctacaatgatgcaatgcatgttgatatg
ctatcagagcaggatagactagaattgatgagaaaaggaagtagtgctaactgtattaat
agtagttctaagatgtatatcggtaagcatgagcggacggccctgaggtgcagaggttcg
attgacttggttgttggggaaggaaaggtacagttgggggaacccaagtctgtaagaagc
cacaaacgtggaagtttgattcgcaatggtatgctggaaaatatggatccagagtttggt
ggtgagcagacaaccttagcggattgtagtcaatatgagaaggtgagggcagtccaattt
aacacccaaaaagtcggacgcaaccaaaacaatacaaaagggctcgataagtttccagtt
gaaaatggtgatttggatgctgaagcgggccagactctgacagaagacctcaagacggca
catcccttacagggaaaacatgcttctgagtattcatcagcagctcagaatgtgaatagg
cgaacattctgtggagaaattggttccagtggggacaaggttgcagaaggatatgacaac
caaaggattcttgcgacgaaggcaaaaatggagaaacgtggggagcgttttaaggagcca
atcaccctgaaaaaagagccagacaagttgtccaagcctgagattgatctagttgaaaca
gctgaagcacagttacataggccaagccgaaagaggaggtggggcggtatagaggctgtt
tag

DBGET integrated database retrieval system