KEGG   Malus domestica (apple): 103426107Help
Entry
103426107         CDS       T03194                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00620  Pyruvate metabolism
mdm00710  Carbon fixation in photosynthetic organisms
mdm01100  Metabolic pathways
mdm01200  Carbon metabolism
Module
mdm_M00168  CAM (Crassulacean acid metabolism), dark
mdm_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mdm_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mdm_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103426107
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103426107
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103426107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103426107
NCBI-ProteinID: XP_008362419
LinkDB All DBs
Position
17
AA seq 961 aa AA seqDB search
MEEAEVDAQVRRAAGGNGEXEATEKQGLEENRDGLKVLPFEFVALEAACSVQDCYELSAE
YERKQDPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKXKKKGD
FADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQTVDLVFTAHPTQSVRRSLLQKH
ARIRNCLTKLNAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE
TIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
ARMMAANLYFSQIEDLMFELSMWRCNDELRARAHELHRSSKKDAKHYIEFWKQIPPNEPY
RVILGDVRDKLYNTRERARQLLANGVSDIPEDTTFTNVEQFLEPLELCYQSLCSCGDRAI
ADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLNAITKHLEIGSYREWSEERRQEWLL
SELRGKRPLFGADVPKTEEIADVLDTFHVIAELPSDNFGAYIISMATSPSDVLAVELLQR
ECGVKEPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSDSGKDAGRL
SAAWQLYKAQEELVKVAKKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVT
VQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMGVIATEEYRSI
VFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVW
LGFGAAFKHVIEKDAKNLQMLREMYNQWPFFRVTIDLIEMVFAKGDPGIASLYDKLLVSE
DLWSFGDRLRANYEQTKLLVLQVAGHKALLEGDPYLRQRLLLRDSYITTLNVCQAYTLKQ
IRDPNYHVKVRPHLSSEYMETTTKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGMQNT
G
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcagaggtagatgcacaagtgagaagagctgctggtggaaacggggaagrt
gaggcaacagagaagcaaggtctggaggagaatcgtgatggtttgaaggttctgcctttt
gagtttgttgcattggaggctgcttgcagtgtgcaagattgttatgagctttcygcggaa
tatgaaagaaagcaggaccctcaaaagttggaggaactygggaaaatgctaacgagtttg
gatcccggggactccatwgtcattgctaaatccttttctcacatgcttaacttggcmaat
ttggccgaggaagttcagatygcgtaccggaggaggatcaagwtgaagaagaagggagat
tttgctgatgaggcktcrgctactacggagtcagacattgaagagactctcaagaggctt
gtgggggacctgaaaaagtccccagaagaagtttttgatgccttgaagaaccagactgta
gatttggttttcactgcacatcctactcagtctgttcgcaggtctttgctccaaaagcat
gcaaggataagaaattgtttgacgaagttgaatgctaaggacattacgcctgatgataag
caggaactcgatgagtctttacaaagggagattcaagctgcatttcgtacagatgaaatc
cgaaggactcctccaacccctcaagatgagatgagggcaggaatgagctacttccatgag
acaatttggaaaggcgtaccgaaattcttacgtcgtgttgacactgctttgaagaacata
gggataaacgaacgtgttccttacaatgcccctctcattcagttttcttcttggatgggt
ggggatcgtgatggaaaccccagggtcactcctgaagttactcgggatgtgtgcttattg
gctagaatgatggctgctaacttatacttctcccagatagaggatcttatgtttgagtta
tccatgtggcgatgcaatgatgagcttcgtgctcgtgcycatgaacttcataggtcttcg
aagaaggatgcgaaacactacatagagttttggaaacaaattcctccaaatgagccttat
cgagttattcttggagatgtaagagacaagctttacaatacacgtgaacgtgctcgccaa
ttattagccaatggagtctctgacattcctgaggacacaacgtttaccaatgttgaacag
tttctggagcctctcgaactttgttaccagtcactctgctcctgtggcgatcgggcaatt
gctgacggaagccttcttgatttcttamggcaagtttctacttttgggctgtctcttgtg
agactagacatacgacaagaatcagacaggcacactgatgtcctcaatgctataacaaag
cacctggagataggatcttatcgagaatggtctgaggagcgtaggcaagaatggctcttg
tctgagcttcgtggcaagcgccccctttttggygctgatgttcccaagactgaagaaatt
gctgatgttctggacacattccatgtcattgcagaacttccctcagacaattttggtgct
tatattatatcaatggcaacatccccatctgatgttctcgctgttgagcttttacaacgt
gaatgtggtgtgaaggagccactaagggttgttccattgtttgagaagcttgctgatctt
gaggctgctcctgctgctgtggctcgtctcttttctatagactggtacaaaaaccggatc
aatgggaagcaagaagtcatgatagggtactcagattccggaaaggatgctggtcgtcta
tctgcagcatggcagttatacaaggctcaggaagagctcgtaaaggttgcaaaaaaattt
ggggttaagcttacgatgtttcatggtcgaggtggaacagttggaagaggaggagggccc
acccatcttgctatattgtctcagccacccgacactattcatggttcgcttcgtgttaca
gttcaaggtgaagttattgagcaatcatttggggaggagcacttgtgttttagaacactc
cagcgtttcacagcagctacgcttgagcacggaatgcaccctcctgtctccccaaagcca
gaatggcgtgcactcatggatgaaatgggcgtcattgcaacagaggagtatcggtcaata
gttttccaggagccccgttttgttgaatactttcgcctcgcaacaccagagatggagtac
ggtcgaatgaacattgggagtcgtccttcaaaacgaaagccaagtggaggcattgaatca
cttcgtgcaatcccatggatctttgcttggacccagacaagatttcacttaccagtgtgg
cttggctttggggcagcatttaagcatgttattgagaaggatgcgaagaatctccaaatg
cttcgggagatgtataatcagtggcctttcttcagagtcacaattgatttaattgagatg
gtgtttgccaagggtgatcccggtattgcctctctgtatgacaagcttctcgtgtcagaa
gacctatggtcatttggcgaccgattgagggccaactatgaacaaactaagctcctcgtc
ctccaggttgctggacataaggctcttctggaaggagatccctacttgaggcagcgactc
ctccttcgtgattcatacatcacgacacttaatgtgtgccaagcctatacactgaagcaa
attcgtgatccaaactaccatgtcaaagtaaggccacatttgtcgtcggagtacatggaa
acaaccaccaagccrgcagcagagcttgtgaaactcaatccaacgagcgagtatgctcct
ggtctggaagacacgctaatcctgaccatgaagggtattgctgctggtatgcagaacacc
ggttga

DBGET integrated database retrieval system