KEGG   Malus domestica (apple): 103428073Help
Entry
103428073         CDS       T03194                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00564  Glycerophospholipid metabolism
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103428073
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103428073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox Pyr_redox_2 GIDA Lycopene_cycl HI0933_like NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 103428073
NCBI-ProteinID: XP_008364419
LinkDB All DBs
Position
1
AA seq 629 aa AA seqDB search
MATAIHLRRLGAAAVVATAASGAFLLQPSLSASDRGAGSSSLGAVRQRISDPNAVVPSRA
AQEAALIGASAANPLDILVIGGGATGCGVALDATTRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAALRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQMNDARLNVG
LACTAALAGAAVLNHAEVVDLLKDEASNRTIGARIRDNLSGKEFNTYAKVVVNAAGPFCD
SLRKMTDQDAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTT
DSNTPITLLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPSAKSTESIS
RDHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGKLTPENGCLTSKLQIVGGDGWD
PASFTVIAQQYVRMKNSHGKVVPGVMDTAAAKHLSHAYGTLAERVAAIAQNENLGKRLAH
GYPFLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAASRALPRVIEILATEHNWDDSR
QKYELEKATEFLKTFKSSKNAQFHDGKHV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctatacacctacgccggctcggagccgccgccgtcgttgctacggcagcc
agcggcgcctttctcctccagccttcgctctccgccagcgaccgcggcgccgggtcctcc
tccctcggcgctgtccgccagaggatcagcgacccgaatgctgtcgttccgtctagggcg
gctcaggaggccgctctgattggcgcgagtgctgccaacccgctcgacattctcgtgatt
ggcggtggcgccaccggctgcggcgtcgcccttgacgcaaccaccagaggcctccgcgtc
ggcctcgtcgagcgcgaggacttctcttctggaacgtcgtcgcggtccactaagctaatt
catggaggtgttcggtacttggagaaagctgtttttaatcttgactacgggcagctgaag
ttggtatttcatgcgcttgaggagcgtaaacaggttattgacaatgcaccgcacctctgc
catgctttgccatgcatgacaccatgttttgactggtttgaggtagtatactactggatg
ggcttgaaaatgtacgatttggttgcagcactacggctcttacatgtgtccagatattat
tctgcacaagaatctgttgagctcttccccacccttgccaggaagggtaacaataaaagc
ttgaagggcaccgtggtgtattatgatgggcagatgaatgacgcgcgtcttaatgttgga
ttggcatgcactgctgccttagctggtgcagcggtgcttaaccatgcagaagtggttgat
ttgttgaaggatgaggctagcaatcggacaattggtgcaagaatccgagacaacttatca
gggaaagagtttaatacatatgcaaaagttgtcgtgaatgctgctgggccattttgtgac
tctttaaggaagatgacagatcaagatgcaaaaccaatgatatgcccaagcagcggtgta
cacatcgtacttcctgactattactctcctgagggtatgggtttgattgttcctaaaact
aaggatggacgtgttgttttcatgcttccttggttgggacgaacaattgctggcaccaca
gattccaacacccctattactctgcttcctgaaccacatgaggatgagattcaattcata
ctggatgccatttgtgattaccttaatgtcaaggtacgccgtacggatgttctctccgcg
tggagtggtattcgtccattggcaacggatccatctgcgaaaagcacggagagcatctcc
agagatcatgttgtatgtgaagattatcctggtttggtaacaatcacgggcggcaagtgg
actacttaccgtggcatggcagaagatgcggttaatgcagcaataaagtctggaaagctg
accccagaaaatggatgtttaacctccaagctgcaaattgtcggtggagacggatgggat
cctgcatcttttacagttatcgctcaacaatatgtgcgcatgaagaacagccatggtaaa
gttgttcctggagtgatggacactgctgcagcaaagcatctatcccatgcatatggtact
ttggctgaacgagttgctgctattgctcagaacgaaaatctggggaagaggcttgcccat
ggatacccttttctagaggctgaggttgcctactgtgcccgaaacgagtactgtgaatct
gccattgatttcattgctcggagatctcggcttgctttcctcgacactgatgcagcaagc
agggcattgccacgtgtgattgaaattttagcgaccgaacacaactgggatgattcgagg
cagaagtacgagttagagaaggccacggaatttttgaaaactttcaaatcttcaaaaaat
gctcagttccatgacgggaaacatgtttag

DBGET integrated database retrieval system