KEGG   Malus domestica (apple): 103431162Help
Entry
103431162         CDS       T03194                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00010  Glycolysis / Gluconeogenesis
mdm00053  Ascorbate and aldarate metabolism
mdm00071  Fatty acid degradation
mdm00280  Valine, leucine and isoleucine degradation
mdm00310  Lysine degradation
mdm00330  Arginine and proline metabolism
mdm00340  Histidine metabolism
mdm00380  Tryptophan metabolism
mdm00410  beta-Alanine metabolism
mdm00561  Glycerolipid metabolism
mdm00620  Pyruvate metabolism
mdm00903  Limonene and pinene degradation
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103431162
   00053 Ascorbate and aldarate metabolism
    103431162
   00620 Pyruvate metabolism
    103431162
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103431162
   00561 Glycerolipid metabolism
    103431162
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103431162
   00310 Lysine degradation
    103431162
   00330 Arginine and proline metabolism
    103431162
   00340 Histidine metabolism
    103431162
   00380 Tryptophan metabolism
    103431162
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103431162
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103431162
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103431162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 103431162
NCBI-ProteinID: XP_008367527
LinkDB All DBs
Position
14
AA seq 541 aa AA seqDB search
MAARRLSSLLSRSLSAASSSSSSSGSAASLLRSRGGSVSRFSSTAVATEELIIPPVQISH
TQHLINGKFVDAASGKKFPTYDPRTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMG
AYERSRILLRFADLVEKNSEELAALETWNNGKPYEQALTAEVPMLARLFHYYAGWADKIH
GLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKSAEQTPLT
ALYVAKLFQEAGLPPGVLNVVSGDGPTAGAALASHMDVDKVAFTGSTDTGKIILELAARS
NLKPVTLELGGKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIE
KAKARAVKRVVGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSBATLECGGGRLGSKGYF
IQPTVFSNVKDDMLIAKDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNIDTAN
YLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcggagactctcctctttactctctcgctccctctcagccgcttcttcttct
tcttcttcttctggttctgcagcttctctgcttcgctctcgagggggaagtgttagcagg
tttagcagtactgctgtagcaactgaggagttaatcattccacctgttcaaattagtcac
actcagcacctaatcaatgggaaattcgttgacgctgcgtcaggaaaaaaatttccaaca
tacgatcctcgtacaggagaagtgattgctcatgtggctgagggtgacgcagaagatatt
aaccgtgcagtagctgctgctcgcaaggcatttgatgagggaccgtggccgaagatgggc
gcttatgaaagatcacggatattattacgctttgctgatttggttgagaaaaacagtgaa
gagctggcagctctagagacatggaataacgggaagccttatgaacaagctctgacagcc
gaagtaccaatgttggctcgtctatttcactactatgctggatgggctgacaaaatccat
ggtctaactgttccggctgatggaccttatcatgtgcaaacgctgcatgaaccaattggt
gttgcaggacagattattccatggaattttcctctactcatgtttgcctggaaagttggg
cctgcactggcttgtggtaacactattgtcctaaagagcgccgagcagacgcctctgact
gccctctatgtsgcaaagctattccaagaggctggtcttcctccgggtgttctaaacgta
gtttctggagatgggccaactgctggtgctgctcttgccagtcatatggatgtggacaag
gtagctttcaccggatcaactgatacyggaaagattattcttgaattggctgcaagaagc
aatcttaagcctgtaacattagagctcggagggaaatcacctttcattatatgtgaagac
gctgacattgatcatgctgtggagcttgcgcactttgctctcttctttaatcaggggcaa
tgttgctgtgccgggtctcgtacttttgtacatgagcgtgtgtatgatgagttcatagag
aaagcaaaggcacgtgctgtgaagcgtgttgttggcgatccctttaagaagggcgttgaa
caaggccctcagatcgacaatgagcagtttgagaaggtccttagatacataagagctggc
attgatagcratgctaccctcgaatgtggaggtggaagattgggctccaagggatacttc
atccagcctactgttttctcaaatgttaaggacgatatgttgatagcaaaggatgagatc
ttcggcccrgtgcaatcaattttgaaattcaaggagctcgaygaagtggtccgaagggca
aatgcaacacgctatggtctagctgccggagttttcaccaaaaacattgacaccgccaac
tacttgacacgggcattgagggctgggacagtctgggtgaattgcttcgacgtgtttgat
gctgcaattccttttggtggatacaagatgagtggaataggcagagagaagggaatctac
agccttcataactacttgcaggtgaaggctgttgtcactcctttgaagaatccggcatgg
ttgtag

DBGET integrated database retrieval system