KEGG   Malus domestica (apple): 103432255Help
Entry
103432255         CDS       T03194                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00630  Glyoxylate and dicarboxylate metabolism
mdm00710  Carbon fixation in photosynthetic organisms
mdm01100  Metabolic pathways
mdm01200  Carbon metabolism
Module
mdm_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mdm_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mdm_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103432255
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103432255
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103432255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 103432255
NCBI-ProteinID: XP_008368660
LinkDB All DBs
Position
17
AA seq 179 aa AA seqDB search
MASSMISSGTVATVSAPAQARMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVW
PPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDG
RYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPPGV
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccatgatttcctccggtaccgtggctacagtttccgcccccgctcaagcc
agaatggttgctccattcactggcctcaagtcctcctcagctttccctgtcaccagaaaa
agcaatgacattacctctattgcaagcaatggaggaagagtgcaatgcatgcaggtgtgg
cctccacttggactgaagaagttcgagaccctctcttaccttcctcccctttctaccgag
tccttggccaaggaagttgactacctcctccgcaaaaactgggttccctgcttggaattt
gagttggagcatggattcgtgtaccgtgagaaccacagatccccaggatactatgatgga
aggtactggacaatgtggaagctgcccatgttcggatgcaccgactcttcccaggtgttg
aaagagctggaagaggccaagaaggcctacccccaatccttcatccgtatcatcggattc
gacaatgtccgtcaagtgcagtgcatcagtttcatcgcttacaagcctccaggcgtctaa

DBGET integrated database retrieval system