KEGG   Malus domestica (apple): 103432365Help
Entry
103432365         CDS       T03194                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00040  Pentose and glucuronate interconversions
mdm00051  Fructose and mannose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103432365
   00051 Fructose and mannose metabolism
    103432365
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103432365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP PALP Methyltransf_25 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 103432365
NCBI-ProteinID: NP_001280964
UniProt: Q5I6M4
LinkDB All DBs
Position
1
AA seq 371 aa AA seqDB search
MGKGGMSDGDHADRCCGEAINGDVQQENMAAWLLGVKNLKIQPYKLPNLGPHDVRVRLKA
VGICGSDVHHFKNMRCVDFIVKEPMVIGHECAGIIEEVGSEVEDLVPGDRVALEPGISCK
RCNLCKQGRYNLCRKMKFFGSPPNNGCLANQVVHPGDLCFKLPDNVSLEEGAMCEPLSVG
IHACRRANVCQETNVLVVGAGPIGLVTLLAARAFGAPRIVIADVNDERLLIAKSLGADAV
VKVSTNIEDVAEEVAKIQKVLENGVDVTFDCAGFNKTITTALSATRPGGKVCLVGMGQRE
MTLPLATREIDVIGIFRYQNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSAR
GGNAIKVMFNL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagggaggcatgtctgatggagatcatgctgatcgctgttgtggggaagcaata
aatggtgatgttcaacaagagaacatggctgcttggcttcttggtgttaaaaacctcaag
attcaaccttacaagctccctaatcttggaccccatgatgttagagtccggctgaaggct
gttggcatatgtggcagtgatgttcaccacttcaagaacatgaggtgtgtagattttata
gttaaagagccaatggttattgggcatgagtgtgctgggatcatagaggaagttgggagt
gaggtcgaggatttggtgccaggcgatcgtgtggcactagagcctggtatcagttgcaag
cgatgcaacctctgcaaacaaggccggtacaatctatgccgcaagatgaagttttttggc
tcccctccaaataatggttgtctggcaaatcaggttgtccatccaggagatctatgtttt
aaactgccagacaatgtgagtttggaggaaggcgcgatgtgtgagcccttaagtgttggt
attcatgcttgtcgccgggcaaatgtctgtcaagaaacaaatgtcttggtcgtgggagca
ggacctataggacttgttacactgctagccgctcgtgcttttggggcgccccgaattgtc
attgcggatgtgaatgacgagcgtttgttgattgcaaagagtcttggcgcagatgcagtc
gttaaggtttcaacaaatattgaggatgtagctgaagaagtggctaagatacaaaaggtt
ttggaaaatggagtggatgtaaccttcgactgtgcaggctttaacaaaaccataacaaca
gctttgagtgctactcgtcccggaggcaaagtttgccttgtgggaatgggtcagagagag
atgactctccctctcgctaccagagagattgatgtaattggaattttccgataccagaac
acatggccgctgtgccttgagtttctgagaagtggtaagattgatgtgaagcccctcata
acacatcggtttggattttctcagaaggaggtggaagaagcctttgaaaccagtgctcgc
ggaggcaatgccattaaggtcatgtttaacctgtaa

DBGET integrated database retrieval system