KEGG   Malus domestica (apple): 103439703Help
Entry
103439703         CDS       T03194                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00040  Pentose and glucuronate interconversions
mdm00051  Fructose and mannose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103439703
   00051 Fructose and mannose metabolism
    103439703
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103439703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3 AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Pyr_redox Pyr_redox_2 FAD_binding_2 Sacchrp_dh_NADP UDPG_MGDP_dh_N TrkA_N Methyltransf_16 MTS
Motif
Other DBs
NCBI-GeneID: 103439703
NCBI-ProteinID: XP_008376511
LinkDB All DBs
Position
Unknown
AA seq 349 aa AA seqDB search
MGKGGKAAEPENMGAWLLGVNNIKIQPFKLPSVGPNDVRVRVKAVGICGSDVHYFKTMKC
ADFEVKEPMVIGHECAGIVEEIGGEVKHLALGDRVAVEPGISCARCQQCKGGRYNLCPDM
KFFATPPVHGSLANQIVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRANVGPESTVL
IIGAGPIGLVSVLAARAFGSPRIVIVDMDDQRLAMAKSLGANDTVKVSTKMEDLDDEIAQ
IKIAMKSDVDVSFDCVGFNKTMSTALGATRPGGKVCLVGMGHGTMTVPLTPAAAREVDVV
GIFRYKNTWPLCLEFLRSGRIAAAVKPALLSRRVLISWTAGSWVVNATK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagggaggcaaagctgctgagccagaaaacatgggtgcttggcttcttggtgtt
aacaacatcaagatccaacctttcaagcttcccagtgtggggcccaatgatgttcgcgtt
cgggtcaaggctgtcggcatttgtggaagtgatgttcactacttcaagacaatgaaatgt
gcagattttgaagttaaagagccaatggtaattggccatgagtgtgctgggatcgttgag
gaaatcgggggcgaggtgaagcatcttgctctcggagatcgtgtggcggtagagcccggg
atcagctgcgcacggtgccagcagtgcaaaggtggaaggtacaatctctgcccggacatg
aagttttttgccaccccaccggttcatggttccttggcaaatcagattgtacatcctgcg
gatctgtgctttaaactcccggagaatgtgagtttggaggaaggggcaatgtgtgagccc
ttgagtgtaggggttcatgcttgccggagagccaatgtcggtccggaatcaactgttctg
atcatcggagccggccccattggtctggtttctgttctggctgcccgtgctttcgggtca
ccaagaatcgtcattgtggatatggatgaccagcgtctagcgatggcgaagtctcttggt
gctaatgacaccgtcaaagtttcgacaaaaatggaagatttggatgatgaaattgcccag
attaagatagccatgaagtccgacgtggatgtgagcttcgattgtgtcggttttaacaaa
accatgtcaaccgctcttggtgccacccgtcccggcggcaaagtttgcctcgtcggaatg
ggacacggcacgatgacagtcccacttactccagctgctgccagggaggttgatgttgta
ggaattttccggtataaaaacacatggccgctttgcctcgagtttttgagaagtgggagg
atcgctgccgccgtgaagcctgctctcttatcgcgacgagttcttatctcttggacagct
ggttcttgggtcgtgaatgcgacaaagtga

DBGET integrated database retrieval system