KEGG   Malus domestica (apple): 103439714Help
Entry
103439714         CDS       T03194                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00040  Pentose and glucuronate interconversions
mdm00051  Fructose and mannose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103439714
   00051 Fructose and mannose metabolism
    103439714
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103439714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox Methyltransf_25 Pyr_redox_3 Pyr_redox_2 FAD_binding_2 Sacchrp_dh_NADP UDPG_MGDP_dh_N MTS Methyltransf_16 DAO
Motif
Other DBs
NCBI-GeneID: 103439714
NCBI-ProteinID: XP_008376522
LinkDB All DBs
Position
7
AA seq 368 aa AA seqDB search
MGKGGQLINEVGKEAKPIKQENMAAWLVDVNTIRILPFQLPSIGPNDVRIRIKAVGICGS
DVHYLKTMKCADFEVKEPMVIGHECAGIVEKVGSEVKHLVPGDRVAVEPGISCSRCQQCR
GGRYNLCPDMKFFATPPVHGSLANQIVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRR
ANVGPETTVLVIGAGPIGLVSVLAARAFGAPRIVIVDMDDQRLAMAKSLGADETVKVSTK
MEDLDDEVDKIKKAMNSEVDVTFDCVGFNKTMSTGLNATRPGGKVCLVGMGHGMMTVPLT
PAAAREVDVVGVFRYKNTWPLCLDFLRTGKIDVKPLITHRFGFTEKEVEEAFATSARGGN
AIKVMFNL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagggagggcaattgattaacgaagtgggtaaggaagccaaacctattaagcaa
gaaaacatggctgcttggcttgttgatgtcaacaccatcaggatcctacctttccagctc
cccagtatcggacccaatgatgttcggattcggattaaggctgtcggcatttgtggaagc
gatgttcactacctcaagacaatgaaatgtgcggattttgaggttaaggagccaatggtg
atcggacatgaatgtgctgggatcgtagaaaaagttggcagcgaggtgaagcatctggtg
cccggtgaccgcgtcgcggtagaacctggtatcagctgctcacggtgccagcagtgcaga
ggaggccgctacaatctgtgcccggacatgaagtttttcgccaccccaccggttcatggt
tccttggctaatcagattgtgcatcctgcggatctatgttttaagctgccggagaacgtg
agcttggaggaaggggcaatgtgcgagcccttaagtgttggggttcacgcttgtcgtcga
gccaatgttggtcccgaaacaactgttctggtcatcggagcagggcccattggtctggtt
tctgttttggccgctcgtgcttttggggcaccaagaattgtcattgtggatatggatgac
cagcgtctagctatggcaaagtctctcggcgctgatgaaaccgtgaaagtttcgacaaaa
atggaggacttagatgatgaagttgacaagattaaaaaggccatgaattccgaagtggat
gtgaccttcgattgtgttggtttcaataaaaccatgtcgacgggtctcaacgccactcgc
cccggcggtaaagtctgccttgtcggaatgggacacggcatgatgactgtccctctaact
ccagctgctgctagggaagttgatgtggttggagttttccggtacaagaacacatggcca
ctttgcctcgatttcttgagaactgggaagatcgacgtgaagccgcttattactcaccgg
tttggattcaccgaaaaggaggtggaagaagcctttgcgaccagtgctcgtgggggtaac
gccatcaaagtcatgtttaatctatag

DBGET integrated database retrieval system