KEGG   Malus domestica (apple): 103444237Help
Entry
103444237         CDS       T03194                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00250  Alanine, aspartate and glutamate metabolism
mdm00410  beta-Alanine metabolism
mdm00430  Taurine and hypotaurine metabolism
mdm00650  Butanoate metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103444237 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103444237 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103444237 (GAD2)
   00430 Taurine and hypotaurine metabolism
    103444237 (GAD2)
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103444237 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103444237
NCBI-ProteinID: NP_001280764
UniProt: V9SJB6
LinkDB All DBs
Position
9
AA seq 501 aa AA seqDB search
MALSRTASESDVSVHSTFASRYVRTSLPRFKMAENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSEAAIG
VGTVGSSEAIMLAGLAFKRKWQNKRRAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKETGWDTT
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRENMVVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDNHRHDEFEISDLLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVNDIKKVLRELDTLPSKLSSNVKAADEEGEKPGTTLESKKSDLEKTR
EITIVWRKFVMARKQKMNVVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcaaggactgcgtcggagtcggacgtctccgtccactcaaccttcgcttct
cgatacgtccgaacttctcttcctaggttcaaaatggcggaaaattcgatcccgaaggag
gcagcgtaccagattataaacgatgagctgatgttggatgggaaccctaggctgaatctg
gcttcgtttgtgacgacatggatggagcctgagtgtgataaacttatgatggcctccatc
aacaagaactacgtcgacatggatgagtaccctgtcaccactgagctccagaatcgatgc
gtaaacatgatagctcatctgttcaatgcaccattgggagattcagaggcagcaattgga
gtgggaacggtgggctcttctgaggccatcatgttggctggcttggcattcaagaggaag
tggcaaaacaagaggagagctgagggcaaacccgttgacaaacccaacattgtcaccgga
gccaatgtccaggtgtgctgggagaagtttgcaaggtactttgaggtggagttgaaggag
gtgaagttgagggatggctactatgtaatggaccctgagaaagcagtggaaatggttgat
gagaacacaatctgtgttgctgctatcctcggctccaccctcaacggtgagttcgaagat
gtcaagctcttgaacgatctcttgatagagaagaacaaggaaactggatgggatactaca
atccatgtagacgcagcaagtggtgggtttattgctccatttctatacccagaactggaa
tgggatttccgtttgccccttgttaagagcatcaatgttagcggacacaagtacggactt
gtgtatgcagggattggatgggtcatctggaggaacaaagaagatttgccggaagaactc
atcttccatatcaactatcttggagctgaccaacctactttcaccctcaacttctcaaaa
ggctccagccaagttattgctcaatattatcaactgattcgcttgggttttgagggatac
aggaacgtcatggaaaattgtcgtgaaaacatggtagtactaaaagaaggattggagaag
acaggtcgtttcaacatagtctccaaagatgaaggtgtacccttggtggccttctctttg
aaggataaccatcgccacgacgagtttgaaatctccgacttgcttcgccgcttcggatgg
atcgttccggcatacactatgcccccagacgcgcaacacatcaccgtgctacgtgttgtc
attagggaagacttctctcgcactttggccgagcggcttgtgaatgacatcaaaaaagtg
ttgagagaacttgacacgcttccatctaagcttagctccaacgtgaaggctgctgatgaa
gaaggtgagaaacctgggacgacacttgagagtaagaagagtgatttggagaaaacaagg
gagatcacgatagtttggaggaagtttgttatggccaggaagcagaagatgaatgttgtt
tgttag

DBGET integrated database retrieval system