KEGG   Malus domestica (apple): 103447738
Entry
103447738         CDS       T03194                                 

Definition
(RefSeq) beta-glucosidase 12-like precursor
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00460  Cyanoamino acid metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103447738
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     103447738
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 103447738
NCBI-ProteinID: NP_001280983
UniProt: G3LY19
LinkDB
AA seq 535 aa
MATKLGSLLLCVLLLNGFALTNTKAANPDRPIVCNSLDRTKFDALKPGFVFGAASAAYQV
EGAWNEDGRGPSIWDTFTHNHPEKITDRSNGDVAIDQYHLYKKDVAIMKDMKLDAYRFSI
SWPRLLPNGTLSGGVNRKGIEYYDNLINELLRNGIQPFVTIFHWDVPQALEDAYGGFLSA
SIVDDFKDYAELCFSLFGDRVKHWITLNEPYTFSNHAYTIGIHAPGRCSAWQDPTCLGGD
SATEPYLVTHHQLLAHAAAVKVYKDKFQAYQNGVIGITLVSHWYEPASDAKEDIDAANRA
LDFMFGWFMDPITRGDYPYNMRCLVRERLPKFTEEESKMLTGSFDFVGLNYYSARYATDV
PKNYSEPASYLYDPHVTTLTERDGIPIGPQAASDWLYVYPKGIHDFVLYTKNKYDDPIIY
ITENGVDEVNNSTLSLDDALYDTNRTDYYNRHLCYLQAAIKKGSNVKGYFAWSILDNFEW
SEGYTVRFGINYVDYDNGLQRYPKLSTYWFKNFLKKRKGSSNILADYVGDTKSVY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggcaacgaagttgggctctttgctcttgtgtgtcttgctactcaatggctttgcattg
acaaacaccaaagctgctaacccagatcgacccattgtctgtaactcacttgacaggacc
aagtttgatgctctaaaaccagggttcgtctttggtgcagcttcagcagcttaccaggta
gaaggtgcatggaacgaagatggtagaggaccaagcatatgggacaccttcacccacaac
catccagaaaaaatcactgatcgcagcaatggagatgtcgccattgatcaataccacctc
tataagaaagatgtagcaattatgaaggatatgaagttggatgcttataggttctctatc
tcatggcccagattgttaccaaatggcacgctaagtgggggtgtcaacaggaaaggaatt
gaatattacgacaatctcatcaatgaactccttcgcaatggcatacaaccatttgtgaca
atctttcactgggatgttccccaagcgttagaagatgcatatggtggtttcttaagcgct
agtattgtcgatgactttaaagactacgcagaactttgtttttcactttttggtgatcgg
gtgaagcactggatcacgttgaatgagccatataccttcagtaaccatgcatatacaatc
gggatccacgcaccgggacgatgctctgcttggcaagacccaacctgcctcggtggagat
tcggctactgaaccctatttggtaacacaccaccaactccttgctcatgcagctgctgta
aaagtatacaaggataaatttcaggcatatcaaaatggggtgataggaataacactagtg
tcacattggtatgagcctgcttcagatgcaaaggaagatatagatgctgcaaatcgagct
ttggattttatgtttggatggtttatggatccaattacaagaggtgactacccgtacaac
atgcgatgccttgttagagaacgattgccaaaattcacggaagaagaatccaagatgtta
actgggtcttttgattttgttggattgaactattattctgctagatatgcaactgatgta
cctaagaattattctgaacctgcaagttacttatacgatccacatgttactacactgact
gaacgtgatggcattcctattggtcctcaggctgcttcagactggttatatgtttatcca
aaaggaattcacgattttgtactctacacgaagaataagtatgatgatccaatcatttac
attactgagaatggcgttgatgaggtcaataattccaccttatcactcgacgatgccctc
tatgataccaataggactgactactacaatcgccacctctgttaccttcaagcagcaatc
aagaagggtagtaatgtgaaaggatactttgcatggtcaattttagacaactttgaatgg
agtgaaggctacacagttcgatttggtattaactatgtggattatgacaatggactccaa
aggtacccaaaactttcgacctattggttcaaaaatttcctcaagaagcgcaaaggaagt
tcaaatattttggccgattatgttggagacactaagtctgtgtattaa

DBGET integrated database retrieval system