KEGG   Malus domestica (apple): 103448046Help
Entry
103448046         CDS       T03194                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mdm  Malus domestica (apple)
Pathway
mdm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103448046
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103448046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Cu-oxidase_2
Motif
Other DBs
NCBI-GeneID: 103448046
NCBI-ProteinID: XP_008385499
LinkDB All DBs
Position
11
AA seq 221 aa AA seqDB search
MQAALAIMAAQTVMLSSPTLFSQFQNPNPHSIPHSFFHGVSLKLPFKSQSMSFAASAAAP
KPLTVVAATKKAVAVLKGTSSVEGVVTLSQENDGPTTVNVRITGLTPGPHGFHLHEYGDT
TNGCISTGPHFNPKQLTHGAPEDEVRHAGDLGNIVANADGVAEATIVDNQIPLTGPNAVI
GRALVVHELEDDLGKGGHELSLSTGNAGGRLACGVVGLTPV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagctttggcgatcatggcagctcagactgtgatgctttcatcccccactctc
ttctcccaattccaaaaccctaaccctcactcaattcctcattccttcttccatggcgtc
tccctcaagctcccattcaaatcccaatccatgtctttcgccgcctccgcggccgcccct
aagcctctcactgtcgtcgccgccaccaagaaagccgtcgctgtcctcaagggcacttcc
agtgtcgaaggagtcgtcaccttgagccaagaaaacgatggtcctacaaccgtgaatgtt
cgtattactggacttacccccgggcctcatgggtttcacttacatgagtatggtgataca
acaaatggatgcatatccacaggaccacatttcaatcctaaacagttgacacatggtgct
cctgaggatgaagtccgtcatgcgggtgacctgggaaacatagttgctaatgccgatggg
gtggcagaggcaacaattgtggataaccagataccattaactggtcctaatgctgtaatt
ggaagagcacttgttgttcatgagcttgaggatgaccttggaaagggtggacacgaactt
agtctaagcactggcaatgcaggtggaagattggcatgtggcgtggttggtttgacaccg
gtgtaa

DBGET integrated database retrieval system