KEGG   Malus domestica (apple): 103449903Help
Entry
103449903         CDS       T03194                                 

Definition
(RefSeq) DNA gyrase subunit B, chloroplastic/mitochondrial-like
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mdm03032]
    103449903
   03400 DNA repair and recombination proteins [BR:mdm03400]
    103449903
Enzymes [BR:mdm01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     103449903
DNA replication proteins [BR:mdm03032]
 Prokaryotic type
  DNA Topoisomerases
   103449903
DNA repair and recombination proteins [BR:mdm03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      103449903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim TOPRIM_C HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 103449903
NCBI-ProteinID: XP_017191727
LinkDB All DBs
Position
12
AA seq 744 aa AA seqDB search
MALLLLRPPPPPPPSYLRFMALRFLSHSSLRPHFPSPSSSSSPSSSSSLARPSLLFNPQP
RAEFPLKGVGSCCAVRNVVSARAFMSSTPATEAFQGTTGSNAYGSDQIQVLEGLDPVRKR
PGMYIGSTGLRGLHHLVYEILDNAVDEAQAGFASKVEVILLADGSVSITDNGRGIPTDMH
PATKKSSLETVLTVLHAGGKFGGSSSGYSVSGGLHGVGLSVVNALSEALEVTVWRDRMEY
QQKYSRGKPVTTLSCHVLPVEFQDRQGTRIRFWPDKEVFTTNIQFDYNTIAGRIRELAFL
NPNLMITLRQEDINPEKNHHNEYFYAGGLVEYVKWLNTDKKPLHDVVGFRKEVDGITIDV
ALQWCSDAYSDTMLGYANSIRTVDGGTHIDGTKASLTRTLNSLGKKSKLIKEKDITLSGE
HVREGLTYVISVKVPNPEFEGQTKTRLGNPEVRRVVDQSLQEYLTEYLELHPDVLDSILS
KSLNALKAALAAKRARELVRQKSVLRSSSLPGKLSDCSSTNPEESEIFIVEGDSAGGSAK
QGRDRRFQAILPLRGKILNIERKDEAAMYKNEEIQNLILGLGLGVKGEDFKKEALRYHKI
IILTDADIDGAHIRTLLLTFFFRYQRALFDEGYIYVGVPPLYKVERGKQAKYCYDEAELK
MLQSSFPSNASYNIQRFKGLGEMMPAQLWETTMNPEQRLLKRLGVEDAAEANIVFSSLMG
ARVDYRKELIKNSASMIDLDKLDI
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcttcttcttcgacctcctcctcctcctccgccctcttatcttcgcttcatg
gccttacgcttcctctcccactcatctctccgccctcacttcccctctccttcttcttct
tcttctccgtcttcgtcttcctcgcttgctcgtccctctctcctcttcaacccccaaccc
agggcggaatttccattgaagggcgttggtagctgctgtgcggttcgaaatgtggtttct
gcaagagcttttatgtcctctacacctgcaaccgaggcttttcaaggcactactggctcc
aatgcttatgggtccgatcagattcaggtattggaaggcttagaccctgttagaaagagg
ccaggaatgtacattgggagcacgggacttcgtggtcttcaccatttggtatatgaaata
ttagataatgcagttgacgaggctcaagccggatttgcttcaaaggttgaggtcattttg
ctagcagatggttctgtgagcatcactgacaatggtcgtgggattccgactgatatgcac
ccagcaactaagaaatcttccttggagactgtgttgacggttttacatgccggtggcaag
tttggtggttcaagtagtggttatagtgtgtctggtggattgcatggtgtggggttatca
gtcgtcaatgccttgtctgaggcgttagaagttactgtttggcgtgatcgaatggaatat
cagcagaagtattctcgtggaaaacctgtgacaactctatcctgtcatgtgcttcctgtt
gaattccaagatcggcaaggaacacgcatcagattttggcctgacaaagaagtcttcaca
actaatattcagtttgactacaacacgatagctggacgaattagggaactagcttttcta
aacccaaacctcatgatcactcttaggcaagaggatatcaatccagagaagaaccaccac
aatgaatacttttatgcagggggtttggttgaatatgtaaaatggctaaatactgataag
aaaccgcttcatgatgtggttggctttagaaaagaagtagatggaatcactattgatgta
gctcttcagtggtgttctgatgcatattcagatacaatgcttgggtatgctaatagcata
cgaactgttgatggaggaacccatattgatggaacgaaggcttcattaacaagaactcta
aatagtcttggaaagaagtcaaaacttatcaaggaaaaggatattactttgagtggtgag
catgtgagagaaggattgacatacgtcatctcggtcaaagttcccaatccggaatttgaa
ggccaaacaaagactaggttgggaaatccagaggtgcggagagtggttgatcaatcactt
caagagtatcttacagaatacttggagttgcatccggatgtactggattcaatcctttca
aagtctttgaatgctctcaaggcagctctggctgcaaagagggcaagagaactagtcaga
caaaaaagcgtgttgagatcatcttctctgccaggaaaactatctgattgctcatcaaca
aatcctgaagaatcagaaatctttatagttgaaggagactcagctggtggaagtgcaaaa
cagggtcgtgataggcgctttcaggccattctgccactgaggggtaaaattctgaacatt
gaaaggaaggatgaggcagcaatgtataaaaatgaagagattcaaaatctaattcttggt
cttggacttggggtgaagggtgaggactttaagaaggaggctctacgttaccataagatt
atcattttaacagatgctgatatagatggtgctcacatccgtactctgcttctgacattt
ttcttcagatatcagagagccttatttgatgagggctacatatatgttggcgttccaccg
ctttacaaggttgagaggggaaagcaagccaaatattgctatgatgaagctgaacttaaa
atgcttcagagctccttcccttcgaatgcgtcttacaacattcagaggttcaaaggcctg
ggggaaatgatgcctgcccagttatgggaaacaacaatgaatcctgagcagaggcttctt
aaacgattaggggttgaggatgctgctgaggcaaacattgtgttttcatcccttatgggt
gctcgggtggattaccggaaggagctcataaagaattctgcgagcatgatcgacctcgat
aagttggatatttaa

DBGET integrated database retrieval system