KEGG   Malus domestica (apple): 103451039Help
Entry
103451039         CDS       T03194                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
mdm  Malus domestica (apple)
Pathway
mdm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    103451039
Enzymes [BR:mdm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103451039
DNA repair and recombination proteins [BR:mdm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     103451039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C BRCT PTCB-BRCT RNA_ligase DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 103451039
NCBI-ProteinID: XP_008388689
LinkDB All DBs
Position
2
AA seq 1075 aa AA seqDB search
MATDETKFSVLCSLFNWMQKSKTSTLKRSKFRRFLDNFCKPANYFSAIRLILPSLDRERG
SYGLKESVLATCLIDALGIARDSEDALRLINWRKGGAKTGANAGNFSLVAAEVLQRRQGL
SSGGLTIKELNDLLDRLASSENRAEKTSVLSTLINKTNAQEMKWIVMIILKDLKLGTSEK
SIFHEFHPDAEDLFNVTCDLKLVCEKLSDRNQRHKRQDIEVGKAVRPQLAMRVGDANIAW
KKFHGKEVVVECKFDGDRIQIHKNGTEVHYFSRNFLEHSEYTHAMSDIIVENVLADRCIL
DGEMLVWDTSSSRFAEFGSNQEIAKAARDGLDSDRQLCYVAFDILYVGDTSVIHQSLKER
HELLQKVVNPLKGCLEILVPNRGLNAHCNEGEPCWSLIATSVDDVEKFFKDTIENRDEGI
VLKDLGSKWEPSDRSGKWLKLKPDYIRAGSDLDVLIIGGYYGSGRRGGVVAQFLVGLAER
PVPNTYPRRFVSFCRVGTGLSDEEIEAVATKLKPYLRKYEYPKKAPPSFYQVTNNSKERP
DVWVESPEKSIILSITSDIRTIKSEVFAAPYSLRFPRIDRVRYDKPWHECLDVQSFIELV
QAGNGTTQRGTDYGGLQDTKKKSKKSPRKEEKRNLSIVPSHFVQTDVSGVKEDTLLFSNM
MFYFVNVPPTHSFDSLHKLVVENGGTFSMNLNNAVTHCVAADGKGIKYQAAKHHGDIIHI
SWVLDCCSQKKLLPLQPKYYLFLSDSSKKLQEEIDDFSDSYYWDLDLAEIKQLLINIHRS
EDSEVVNYYKKKYCPVERWSRFHDCCIYFKSSIHSLKPDWEVVLGFTLRRLRIEVLRGGG
RVTDSLVHATHLVVLSVQGPDGFETLLRSFTEADKRYLHSKRLHIVGSQWLEDCLERDQR
LQEETYSLKPYGLEESNVEEWKHDMGLEEAPCDVDAVENHSSSFPNRKGKEIEVKAAPEN
CKILDSPERGSKRKRGRPARTSLNKGKSTVNQARRAWARIGRKPAKISGNESEESGSHDN
TSLGEEVDLGERIHGTVGQESIDIQENEAMKDSELLQRGKAVEQDVAEDIRIEEP
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgacgagaccaagttcagcgtgctctgcagcctcttcaactggatgcagaaa
tccaaaacctcaaccctaaagcgttccaaattccgcagatttctcgacaatttctgcaaa
cccgccaattacttcagcgccattcgcctcattcttcccagcctcgaccgcgagcgtggc
tcctacggcctcaaggagtccgtgcttgccacctgcctcatcgacgccctcggcatcgcc
agagactccgaggacgctctccgcctcattaattggcgcaaaggtggcgccaagaccggc
gccaatgccgggaacttctccctcgtggcggcggaggtgttgcaacgtagacaggggttg
agttcaggtggactaacaatcaaggagttaaatgacttgcttgatcgtttagcttcgagt
gaaaacagggcagagaagacttcagttctttcaaccttgataaacaagacaaatgcacag
gaaatgaagtggattgtcatgatcattcttaaagatctgaagctgggaactagtgaaaag
agcatctttcacgaatttcatccagatgctgaagatttgtttaatgtcacatgcgacttg
aaattggtctgtgaaaagctcagtgatagaaatcagcgccataaacgccaggacattgaa
gttggaaaagctgtgcgcccacaactagctatgagagttggtgatgcaaatattgcatgg
aaaaagtttcatggtaaggaagtggttgttgagtgtaaattcgatggcgatcgcatccaa
attcataagaacggaactgaagtacattacttctcaaggaattttcttgagcactctgaa
tacacacatgcaatgtcagacattatcgtagaaaatgtgctggctgataggtgtattctt
gatggtgagatgttggtctgggacacatcttctagtcgttttgctgagtttggttcaaat
caagaaatagccaaggcagcaagggacgggcttgacagtgatagacagttgtgctatgtt
gcattcgatatcctctatgttggagatactagtgtgattcaccagagcttgaaggaacga
catgagcttctccagaaagttgtgaatccattgaagggttgtttagagattttagtaccc
aatcgtggtcttaacgctcactgtaatgaaggggaaccttgctggtcgcttattgctact
agtgtggatgatgttgagaagtttttcaaagataccatcgaaaatagagatgaggggatt
gttttgaaggaccttggttcgaaatgggaacctagtgatcgtagtggaaaatggttaaaa
ttaaagccagactacattcgtgcaggttctgatctggacgttcttatcataggaggatac
tatggctctggacgtcgtggaggagtggtagctcagttcttggtgggtcttgctgagcgt
ccagttccaaatacatatcctagaaggtttgtatccttttgcagagtgggcactggactt
tctgatgaagagatagaagctgttgcaacaaaattaaagccgtatttgaggaaatatgag
tacccaaaaaaggcaccaccaagtttttatcaagtaacaaacaattctaaagagagacca
gatgtttgggttgaaagccctgagaaatcaataatactttctataacaagtgacatcaga
actataaagtctgaggtttttgctgcaccatacagcctgagatttccacgtattgatcgt
gttagatatgataaaccttggcatgaatgccttgatgtgcagtcatttatagagcttgta
caagcaggcaatgggaccacacaaagggggacggattatggtggtctgcaggatactaaa
aagaaaagcaagaagtcccctagaaaggaagagaaaagaaatctgtctattgtcccctct
cattttgttcagactgatgtttcgggcgtgaaggaggacacattactattttcaaatatg
atgttttactttgttaatgtgcctcccactcattcttttgattccttgcacaagctagtt
gttgagaatgggggtactttctctatgaatttaaataatgctgttacacactgtgttgca
gctgatggcaaagggatcaagtatcaggcagcaaagcatcatggagatatcattcatatc
tcttgggtgttggattgttgttctcaaaagaaactccttccattacagccaaagtactat
ctcttcttatctgactcttctaagaagttacaagaagagattgatgatttttctgactcg
tactactgggatcttgaccttgcggagataaagcagcttttaatcaacattcatagatca
gaggactccgaagttgttaactattacaagaaaaaatactgtccggtggagagatggtct
cgctttcatgactgctgcatttactttaaatcctcaattcattccttgaagccggattgg
gaagttgtcttaggattcacactgagaaggttgaggattgaagttctcaggggtggtggc
agagtcactgacagtcttgttcatgcgacccatttggtagtcttgtccgtgcagggtcct
gatggatttgaaactttattacgaagtttcactgaagcagacaaacgatatctgcatagc
aaaaggttgcatattgttggatctcaatggttggaagactgcttggaaagggaccaaaga
ttgcaagaggaaacatatagcttaaaaccctatgggttggaagaatccaacgttgaagaa
tggaaacatgacatgggtctagaagaagcaccctgtgatgtggatgctgtggaaaaccac
agttcttcttttcctaaccggaaaggaaaagagattgaagtaaaagcggctccagaaaac
tgtaagatcttggactcacccgagaggggaagcaaaaggaaaaggggaagacctgctcgc
acaagcttgaacaaaggaaaatcaactgtcaaccaagctagaagagcatgggcgcgtatt
ggaaggaagccagctaaaatatctggcaacgagtcagaagagagtggctctcatgacaat
acatcacttggggaagaggttgatctgggagaaagaattcacggaacggtaggtcaggaa
agtatagacatccaagaaaatgaagcaatgaaagattctgaattgttacaaagaggcaaa
gcagttgagcaagacgtcgctgaggacattagaattgaagagccttaa

DBGET integrated database retrieval system