KEGG   Malus domestica (apple): 103451194Help
Entry
103451194         CDS       T03194                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00052  Galactose metabolism
mdm00500  Starch and sucrose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103451194
   00500 Starch and sucrose metabolism
    103451194
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103451194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103451194
NCBI-ProteinID: XP_008388850
LinkDB All DBs
Position
12
AA seq 899 aa AA seqDB search
MDRRLHLPFFFFFLSVFYLASSAKAIAEAEAAVGYGYRILSVNYYDSSRNSLTANLGLIK
PSSLYGPDIPNLNLHASYETKDRLRIRITDSKQQRWEIPQNMIPXQTKTPTPTPHCISSS
DFVFTLRNTTPFGFTXTRRSSNDVIFDTSPKSSDPNTXLVFKDQYIQLSSSLPQNRSSIF
GLGEHTKSSFKIIPNQTLTLWNADIGSVNPDLNLYGSHPFYLDVRSASQDGGKTGAGTSH
GVLLLNSNGMDITYSGARITYKVIGGIVDLYFFSGPTPELVVEQYTELIGRPTPMPYWSF
GFHQCRYGYKNVSDVEGVVAGYAKASIPLEVMWTDIDYMDAYKDFTLDPVNFPLDRMKKF
VNTLHQNGQKYVLILDPGISNNDTYETYIRGKKADIFIKRNGIPYLGSVWPGDVYFPDFA
HXRTEKYWANEIQIFQDALPFDGLWLDMNEISNFITSPPTPSSTLDDPPXKINNSGVLRP
INNKTVPAXXLHFGNITEYNAHNLYGLLEAKATNXALINVTGKRPFILSRSTFVSSGKYT
AHWTGDNSAQWSDLAYTIPGILNFGLFGVPMVGADICGFSGNTTEELCRRWIQLGAFYPF
SRDHSDKFTIRQELYLWDSVAETSRKVLGLRYRLLPLFYTSMYEAHKKGTPIARPLFFSF
PQDTTTYEVNTQFLIGRGVMVSPVLKPGVNSVDAYFPAGNWFDLFNYSKSVSVSSGQYIR
LDAPPDHINVHVHEGNILALQGEALTTQAARKTAFELLVVFSSXGQITGEVFLDBGEEIE
MGGEGGKWSLVRFXSGTEKGSVFVSSNVVNGGFALSEKWIIDKVTFIGLEKVGHGFEGYA
LNIAKGANLKGNSDMRASFDRNKQFVTVVISDLSILIGAEFKLELKPKHTAERTLQRTI
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcgtctgcatctgccattcttcttcttcttcttgtctgttttctatcttgca
tcatctgcaaaagcaattgcagaagcagaagcagcagttgggtatggatacagaattcta
tctgtcaactactacgattcctccaggaactcattgaccgctaatcttggcctcatcaag
ccctcctccctctacggacctgacatcccaaatctcaatcttcacgccagctatgaaacy
aaagatcgtctaagaattcgaattacagactcaaagcaacaacgatgggaaatcccacaa
aacatgattcccmrtcaaaccaaaacgcccacccccaccccccactgcatctcctccagc
gactttgtcttcactcttcgcaacaccaccccattcggcttcactrtcacccgccgctcc
tccaacgacgtcatcttcgacacctcccccaaatcatcagaccccaacacctwcttggtc
ttcaaggaccaatacatccaactctcctcttctctcccccaaaacagatcctccattttc
ggcctcggcgagcacaccaagtcctccttcaagatcattcccaaccaaacattgactctc
tggaatgctgacattggtagcgtcaatcccgacctcaacctttacgggtcccaccctttc
tacctggacgtcaggtcsgcgtctcaagatggcggcaagaccggtgcaggaacatctcat
ggggtgttgctgctgaatagtaatggcatggacataacatacagcggtgctaggattact
tataaggtaattggtggaattgtggacttgtacttyttttctggaccgacrcctgagttg
gtggtagagcaatatacagaactcattggtcgccctacccctatgccctactggtctttt
ggattccaccagtgtcgatatggttacaagaatgtttccgatgttgagggcgtggttgct
ggttatgcaaaagccagtatccctcttgaagttatgtggacggacattgattacatggat
gcttacaaggacttcactctcgatcccgtcaactttccattggataggatgaagaaattt
gttaacactcttcaccaaaatggtcagaaatatgtcctcatcttggatcctggtatcagt
aacaatgatacctatgaaacctacatcagaggraagaaagcagatatattcatcaagcgc
aatggaattccttacctgggaagtgtatggcctggtgatgtctacttccctgactttgca
catcmacgtactgaaaaatattgggctaatgagatacaaatatttcaagatgctctgcct
tttgacggtctttggctcgacatgaatgagatatccaatttcataacctctcctcccact
ccatcttckacacttgatgaccctccttwcaagattaacaattctggagtcctkcgtccs
atcaataacaagactgttccggcawcarcgctgcactttggtaacattacagaatataat
gcacataacctstatggactcttggaagccaaggcaacaaacraggccttaatcaatgta
actggtaaaagaccgtttatactttctagatcaacttttgtaagctccggtaagtacaca
gcacactggactggagataattctgcacaatggagtgatctagcatacacaattccaggc
attctaaattttggacttttcggagttccgatggttggagctgatatatgtggattctct
ggaaatactactgaagaactctgccggcgatggattcagctaggggccttttaccccttt
tcaagagatcactcagacaagtttacaatccgtcaagagctctatctatgggattcagtg
gcagaaacatccaggaaggtkcttgggctgcgctatcggttgctccccttattttacaca
tcaatgtatgaggcacacaaaaagggaaccccaattgcaagaccccttttcttctcattt
cctcaagataccacaacttacgaggtcaatacgcagtttctgattggtagaggtgtaatg
gtatcacctgtgttgaagccaggagtcaattcagttgatgcatattttcccgctggaaac
tggtttgatctcttcaactactcgaaatcagtaagtgtaagttcaggacagtacattagg
ctggatgcgccgcctgatcayatcaacgtgcatgtccacgaaggaaatattttggcgttg
caaggggaggccttgacaacacaagcggcccgaaagactgcwttygagctcttggtagtt
tttagtagcarcggacaaattacaggagaagttttcttggacracggagaggaaattgaa
atgggaggagagggaggtaagtggagtttagtgagatttwatagtggaacagaaaaggga
agtgtatttgtaagctcaaatgttgtaaatggaggattcgctttaagcgaaaaatggatc
attgataaagttaccttcattgggttggaaaaggttggtcatggatttgaagggtatgcg
ctcaacattgctaagggagcgaatttgaagggaaactcagacatgagagcaagctttgac
aggaataagcagtttgtcacagtagtgatttccgacctttcgattcttataggagcagag
tttaagttggagttgaagccgaaacatactgctgaacgcactttgcagagaacaatctga

DBGET integrated database retrieval system