KEGG   Malus domestica (apple): 103451955Help
Entry
103451955         CDS       T03194                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00010  Glycolysis / Gluconeogenesis
mdm00053  Ascorbate and aldarate metabolism
mdm00071  Fatty acid degradation
mdm00280  Valine, leucine and isoleucine degradation
mdm00310  Lysine degradation
mdm00330  Arginine and proline metabolism
mdm00340  Histidine metabolism
mdm00380  Tryptophan metabolism
mdm00410  beta-Alanine metabolism
mdm00561  Glycerolipid metabolism
mdm00620  Pyruvate metabolism
mdm00903  Limonene and pinene degradation
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103451955
   00053 Ascorbate and aldarate metabolism
    103451955
   00620 Pyruvate metabolism
    103451955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103451955
   00561 Glycerolipid metabolism
    103451955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103451955
   00310 Lysine degradation
    103451955
   00330 Arginine and proline metabolism
    103451955
   00340 Histidine metabolism
    103451955
   00380 Tryptophan metabolism
    103451955
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103451955
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103451955
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103451955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103451955
NCBI-ProteinID: XP_017192450
LinkDB All DBs
Position
13
AA seq 534 aa AA seqDB search
MVTRRVGSLLNRSFTSASMFSKXRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLING
QFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRV
LFRFADLIEKHNDEIAALETWDNGKPFEQAAKIEVPMVARFFRYYAGFADKIHGLTVPAD
GEYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVAPALACGNTIVLKSAEQTPLSALYAATL
LQEAGLPPGVLNVVSGFGPTAGASLASHMDVDKVAFTGSTDTGKKILELAAKSNLKTVTL
ELGGKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKGRAE
RRLVGDPFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFS
DVKDDMRIASEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDTANTLTRALR
VGSVFINCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggtgactcggagggtcggctcgcttttgaatcgttccttcacttctgcttctatgttt
tccaaagsgaggtcttcttctgtggttagaggaattggtaaatatagcaccgatgcttcc
attgagtcaccaatctctccatccgtcaaagtaaattatactcarcttctaattaatgga
caatttgtagattctgcatcagggaaaacttttcccacattggacccccggactggggaa
gtgattgctcatgtcgctgaaggcgatgctgaagatgtaaaccgcgcagtttctgctgcc
cgcaaggcctttgatgaaggaccgtggcctaagatgacagcttatgaaagatcacgagtc
cttttccgctttgctgatttgattgaaaagcacaatgatgaaattgcagcccttgagact
tgggataatgggaagccatttgaacaggctgctaaaattgaagtaccaatggtggctcgg
ttttttcgttactatgctggatttgcggacaagattcatggtctcacggttccagccgat
ggagagtatcatgtgcaaaccttgcatgaacctatcggtgttgcaggtcagattatacca
tggaatttccctcttctcatgtttgcttggaaggttgcgcctgctttagcatgcggcaac
accattgttctgaagtccgcagagcagacaccgttgtctgctctatatgcagcaaccctg
ttgcaagaggccggacttcctccaggtgttttgaatgtggttagtggttttggtccaact
gccggtgcatctcttgctagtcatatggacgttgataaggttgcgtttactggatcaact
gacacaggtaaaaaaatacttgaattggctgccaaaagcaatcttaagaccgtaactttg
gagcttggtgggaaatccccgttcattgtatgtgaggatgctgatgtagataaggctgtt
gagatggcacatttcgctctattctttaatcagggtcaatgctgctgcgctggttctcgt
acttttgtacatgaaaaagtatatgacgagttcttagagaaagcaaaaggccgtgctgag
agacgccttgttggagacccgttcaaagggggcattgagcaaggtcctcagatcgattca
gatcaatttgagaagatcctgaagtacatagattacggtgttaaagctggagctaaactg
gaaaccggaggagagagggttggcacaaagggtttctatattaagcccaccgtattctca
gatgttaaggatgacatgcgaatagctagcgaagagatatttggtccggtgcagaccatc
ttgaagtacaaggatctaaatgaggtgatacgaagggcaaataactctcgctatggactt
gctgcaggggtctttacacaaaacatagacactgcaaacacattgactcgcgcattgcgc
gtcggtagtgtatttataaactgcttcgatgtctttgatgcctctattcctttcggaggg
tacaagatgagtggaatcggaagagagaagggcatttacggtctttccaattacttgcaa
gtcaaggctgttgtcacccccctgaagaatcctgcatggctatga

DBGET integrated database retrieval system