KEGG   Malus domestica (apple): 103452890Help
Entry
103452890         CDS       T03194                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00071  Fatty acid degradation
mdm00592  alpha-Linolenic acid metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01212  Fatty acid metabolism
Module
mdm_M00087  beta-Oxidation
mdm_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103452890
   00592 alpha-Linolenic acid metabolism
    103452890
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     103452890
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     103452890
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     103452890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 RNA_pol_Rpb1_4 NAD_binding_2 DAO Pyr_redox F420_oxidored
Motif
Other DBs
NCBI-GeneID: 103452890
NCBI-ProteinID: XP_008390640
LinkDB All DBs
Position
13
AA seq 725 aa AA seqDB search
MGSSGKGRTVLEVGADGVALITIINPPVNSLSIDVLFSLKDSYEEALRRNDVKAIVVTGA
KGKFSGGFDITAFGGLQEGQKQEPKPGFISVEVITDIVEGARKPSVAAIDGLALGGGLEV
AMACHARISTPTAQLGLPELQLGLIPGFGGTQRLPRLVGISKALEMMLTSKPVKGEEAHD
LGLVDAIVSPDQLVSTARRWALDILERRRPWVASLHKTDKLEPLGEAREILKFARAQVRK
QAPNLKHPLVCIDVVEEGIASGGRSGLWKEAESFQGLLRSDTCKSLVHVFFAQRGTSKVP
GVTDRGLMPRRVTKVAVIGGGLMGSGIATALILSGYPVILKEVNDKFLQAGISRVRANLQ
SRVKKGKMTQEKFEKTTSILKGVLDYDSFRDVDMVIEAVIEKVSLKQQIFADLEKYCPQH
CILASNTSTIDLNLIGEKTKCHDRIIGAHFFSPAHVMPLLEIVRTNQTSPQVIVDLLEVG
KRIKKTPVVVGNCTGFAVNRMFFPYTQAALLLVEHGADVYQIDRVITKFGMPMGPFRLAD
LVGFGVAIATGTQFVVNFPERTYKSLLIPLMQEDGRAGETTRKGFYTYDDRRKASPDPQL
KGYIEKSRSISGVSIDSKLLKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAAIM
GMGFPPYRGGILFWADLLGSEYIYSRLEEWSNTYGEFFKPCAYLAERASNGASLSSPLKQ
SKSRL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcagcggaaagggccggacagttctggaagtgggagccgatggcgtggctctc
atcaccatcatcaacccacctgtcaattccctctcaatcgatgtgttattcagcttgaaa
gacagttatgaggaggccttgcgaagaaatgatgtgaaggcgattgttgtaacaggtgct
aaaggaaaattttcggggggtttcgatattactgcttttggtggactccaagaggggcag
aagcaggagccgaagcccggttttatatccgtggaggttatcactgacattgttgaaggt
gctaggaaaccgtcagttgccgccattgatggccttgcactggggggaggtttggaggtg
gcaatggcatgccatgcccgaatatcgactcctactgcacaattagggttgcccgagctg
cagcttgggctcattcctggatttggaggaacacaacggcttccacgtcttgttggaatc
tcaaaggcacttgagatgatgctgacatcaaaaccagttaaaggggaagaggctcatgat
ttaggccttgtcgatgctattgtttcacctgatcagttggtaagcactgcacgtaggtgg
gcgttggatatcctggagcgtagaagaccgtgggttgctagtcttcacaaaactgacaag
ttagagccccttggagaagctagggaaatacttaaatttgcaagagctcaagtccggaag
caggctcccaatctcaaacacccattggtttgtattgatgttgttgaggagggtatagct
tctggtggtcggtctggactttggaaggaggctgaatcatttcaaggacttctgcggtct
gacacttgcaagagcttagtccacgtcttctttgctcaacgtggaacatcaaaggtacct
ggggttactgatcgtggtttgatgcctagacgagtgactaaagttgctgtcattggtgga
gggttaatgggatctggaatagctactgcattgattcttagtggttatcctgtgatcctg
aaagaagtaaatgataagttcttgcaggctgggattagtagagtcagagccaatctgcag
agccgcgtcaagaaggggaaaatgacccaagaaaagtttgagaagacgacctctattctt
aagggtgtcctggattatgatagctttagagatgtggatatggtcatagaggccgttatt
gagaaggtttctctaaagcagcagatttttgctgatcttgaaaaatattgcccacaacac
tgcatactcgcaagtaatacttccacaatcgacttgaacctcattggagagaaaaccaag
tgtcatgatcggattattggtgcccatttctttagtccggcacatgtcatgccgcttctg
gaaattgttcgtactaatcagacatctccccaagttattgttgatttgctagaagttggg
aaaagaataaagaaaaccccagtggttgttgggaattgcacaggatttgctgtgaacaga
atgttctttccttatacgcaggctgctctcttgcttgttgaacatggtgccgatgtttat
cagattgatagggtaatcaccaaattcggaatgcctatgggcccattcagattggctgat
ctggttgggtttggcgtggcaattgcaactggcacacaatttgttgtgaactttcctgag
cggacatataaatcattgctaatccctttgatgcaggaggatgggagggcaggtgaaact
acacgaaaggggttctatacttatgatgacaggcgcaaagctagcccagatcctcagttg
aaaggatatattgagaagtcaaggagcatttcgggtgtttccatagattctaagctgctg
aagttatcagaaaaggacattgttgagatgatatttttccctgtcgtaaatgaggcatgc
cgggtgcttgctgaaggcattgctgtgaaagctgccgaccttgacattgctgcaattatg
ggcatgggtttcccaccatacaggggaggtatcttgttctgggctgatttacttggatcc
gaatatatatattcacgattggaggaatggtcaaatacttatggtgaatttttcaagcct
tgcgcctatttggctgaaagagcttcaaacggggcttctctgagttctccgttgaagcaa
tcaaaatctcggttataa

DBGET integrated database retrieval system