KEGG   Malus domestica (apple): 103455676Help
Entry
103455676         CDS       T03194                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00250  Alanine, aspartate and glutamate metabolism
mdm00410  beta-Alanine metabolism
mdm00430  Taurine and hypotaurine metabolism
mdm00650  Butanoate metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Module
mdm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103455676 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103455676 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103455676 (GAD1)
   00430 Taurine and hypotaurine metabolism
    103455676 (GAD1)
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103455676 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103455676
NCBI-ProteinID: NP_001280986
UniProt: V9SI88
LinkDB All DBs
Position
14
AA seq 503 aa AA seqDB search
MVISTTSAEGRGEQVNCTFASRYVRNVLPKFQMPETSMPKDSAYQIINDELMLDGNPRLN
LASFVTTWMEPECDRLMMASMNKNYVDMDEYPVTTELQNRCVNIIANLFNAPIGDGETAV
GVSTVGSSEAMMLAGLAFKRKWQNKRKLEGKPFDKPNMVTGANVQVCWEKFARYFEVELK
EVKLSEGYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKLLHDLLVEKNKQTGWDT
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDE
LIFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCMENTRMLKQGLE
KTGRFKILSKDIGVPLVAFSLKDSSKHTVFEVADSLRKFGWTVPAYTMPANAEHVAVLRV
VIREDFSRGLAERLISDIDKVMREVDTLPSQVSSKTAHVTPTVDEVVRDSEVAVKSTVHK
SETEAEQEIVSRWKGIVKKRGAC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctcaacgacttccgctgagggtcgtggagagcaggtgaactgtacctttgct
tccagatatgtgcgtaacgtcctccctaagtttcagatgccggagacgtcgatgccaaag
gactcggcgtatcagataataaacgacgagctgatgctggacgggaatccgcggctgaac
ttggcgtcgttcgtgacgacgtggatggagcctgaatgcgatcggctgatgatggcttcc
atgaacaaaaactacgtcgacatggatgagtaccctgttactactgaactccagaatcgt
tgtgtgaatattatcgcaaatctgtttaatgctcccattggagacggcgaaactgctgtt
ggtgtgtcaacagtaggttcttcagaggcaatgatgctggcaggcctagctttcaaaagg
aagtggcagaacaagagaaaattagagggaaagccttttgataagcctaacatggtcacc
ggagctaatgtgcaggtttgttgggaaaaattcgctaggtatttcgaagttgaactgaag
gaggtgaagctgtcggagggatactacgtgatggaccctgcgaaagcagttgagatggtt
gatgagaacactatctgtgttgctgctattctaggctcaaccctaactggagagttcgaa
gacgtgaagctccttcatgatctccttgttgaaaagaataagcagacgggctgggacact
cccattcatgtcgacgctgccagcggaggctttattgctccgtttctgtatcccgagctc
gagtgggatttccgcttgccgttagtcaagagcatcaatgtgagtggtcacaagtatggc
cttgtgtacgccggtgttgggtgggttgtgtggaggagtaaggaggacttgccggacgag
cttatatttcacatcaattaccttggatctgatcagcccactttcaccctcaacttttct
aaaggttctagccagataattgctcagtattatcagttcattcgactcggttttgagggt
tacaaaaatgtgatggaaaactgcatggagaatacaagaatgctgaaacaaggactagag
aaaacagggcgatttaaaattctctccaaagacataggagtgccactcgtggccttttct
ctaaaagacagcagcaagcacaccgtgttcgaggtagcagatagtttgaggaagttcgga
tggacagttccagcctacacgatgccagccaatgcggaacatgtagctgttcttcgcgtg
gttattagggaggatttcagccggggcttagcggagaggctcatctcagacattgacaaa
gttatgagggaagtagacacactcccgagccaagtgtctagcaaaactgcccatgtcacg
cctaccgtcgatgaagtagtccgtgacagcgaggtggctgtgaaatctactgttcataag
agcgagacagaggctgagcaagagatagtgtcgcgctggaaggggattgtgaagaaaaga
ggcgcatgctag

DBGET integrated database retrieval system