KEGG   Malus domestica (apple): 103456316Help
Entry
103456316         CDS       T03194                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103456316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdm03036]
    103456316
Enzymes [BR:mdm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103456316
Chromosome and associated proteins [BR:mdm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103456316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 103456316
NCBI-ProteinID: XP_008394239
LinkDB All DBs
Position
15
AA seq 368 aa AA seqDB search
MPAMKKNSERSHIGNVFNKLLKQIGNPVDFELPDWFNKWKPMPYTFIKRNIYHTKRIKRR
LEDDGIFCSCNPSLESSSVCGRDCHCGMLLSSCSSACKCGSSCLNKPFQHRPVKKMKLVK
TEKCGSGIVADEDIKQGEFVIEYVGEVIDDKTCEQRLWNMKHRGETNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIKMGEHLTYDYQFVQFGADQD
CHCGAIGCRRKLGVKPTKSKISSDAALKLVACQVAVSSPKLKAIISAKDVIQNGGLHIGN
SEPIHNQSDRXSCNCIGEVIRISRPPNQWSFGIIKRFDKYSRKHSIMFEDGGIEFLDMSK
EDWELVTL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctatgaagaagaattctgagcgaagtcacattgggaatgtcttcaacaagttg
ctgaagcagattggaaaccctgttgattttgaacttccagattggttcaataagtggaaa
cccatgccctacacttttatcaagcgcaatatatatcacaccaagaggattaaaagacga
cttgaggatgatggcatattctgttcctgcaacccatcactagagtcttctagcgtttgt
ggtagagattgccattgtgggatgcttctgtctagctgctcctcagcttgtaaatgtgga
agttcctgtctgaacaaaccgttccagcacagacctgtgaagaagatgaaactggttaag
actgagaaatgtggttcyggaattgtggcggatgaagatattaagcaaggagaatttgtg
atagaatatgtgggagaagtgattgatgacaaaacatgtgagcaaaggctgtggaatatg
aaacaccgtggagaaacaaacttttacttatgtgaaatcaatcgagatatggttattgat
gccacatacaagggaaacaagtcaagatatataaaccatagttgttgtcctaatactgag
atgcaaaaatggataatcgatggtgaaacaagaattggtatattcgcaactcgtgacata
aaaatgggcgagcacctgacctatgattatcagtttgttcaatttggcgcagatcaagat
tgccattgtggtgcgattggttgtcgacgaaaacttggtgtcaaacctaccaagtcaaag
atatcgtcagatgctgcgttgaaactagtagcatgccaggtggctgtgtcctcccctaaa
ttgaaagctattatctctgcaaaagatgttattcagaatgggggtctgcatattggaaat
tcagaacccatccataaccaaagcgatagaygttcttgtaattgcattggagaagtgatt
cgaataagtcgccccccaaatcagtggtcttttgggattatcaaacggtttgataaatat
tccagaaaacactcgatcatgtttgaagatggtggcattgaattccttgacatgtcaaaa
gaagattgggagcttgtaacattgtga

DBGET integrated database retrieval system