KEGG   Methylomonas denitrificans: JT25_014525
Entry
JT25_014525       CDS       T04191                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn00620  Pyruvate metabolism
mdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JT25_014525
Enzymes [BR:mdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     JT25_014525
SSDB
Other DBs
NCBI-ProteinID: AMK77677
UniProt: A0A126T6G2
LinkDB
Position
3147437..3150913
AA seq 1158 aa
MDKLRALGLGPVGQDEQVVKQQLHLYINLKLASCGQPTCIDTGSAQFMDTAQDLLNSYLE
KSRLLASSSLYPADRRIQDFLERYCADLGLAKIPSLPTMTFELDKHGVARELSLPLGEEE
FRSEIVSSFRVKQGILHNPASDRRTTQGSFHVAEGGLPVPGDKKQVPKLTFALMLGEALN
PPDDLMVLPFTAHQPKPARMFASLLMRPVVCPEIPGVAAEKSMEIRFFAPGNLVSNLDFV
ESIFGNGGNPALPECDAALDVEHWSGHSGCVILAPHLTKLTKKQLGLPHWDEASDRQRAD
GMCWQGPAELYNEGQAFKLTARDRSGVIVTLLADNYYGYCKKEVKTQISYAANLFGLAEE
EHAGGALAFRRINHGDEFGIGSLTREPGYDFDEMTYHYGAIMDVHPEGYAVDRHFPEIIY
VPQDLRMSLATQKITWIRNGQSHSIRLQPGKIYVQPNGYKIEMCKHPGAPSWRLVGTVAE
GTFCHKPCTVSGGGKSEISKSIEDAAIYGPLFVDDLQHDLDRVQAIFDKDYTGRFLPGFE
REDRGPSRTVLSSERSLGSVIKLLTPSPNHTREFNDWLRSIPPSILALVFLIKRFYRPEW
GNNWRDNLSVDVIDGAPGHELKLNQRKIVATYLRVGFDLDGGWRTFKVRQDYIACEKVQM
EDDISASVVVPTEAVRAWLPDEGYEMSLKLVSNCEYRLFQRPDDAIIPGYDKQTELNMSG
PGNFMANFEPLDHEQLSAIVEDVMTFSKFTAPMQKLLTDAYQDGKGFVVCSAHPRLVNGK
PSKNPRYLETRVDVVKPLRKYVAELGARLHRKIPLNQPLCHPVDAVLTGRRNNPPEPGIR
ALAVYNPIHYQELPELFMDFVCSLTGKSPSTTGAGSEGALTKGPFNALRGTADLNNALVS
FILTGYPGFSSSAGFIGPDTRVDHDISLLIPEIWARLSREERHPAFLLEHGYLEPLNDFE
HKGQIVLASRLGYRITSHFVHGLMGKIFDNPYAVFTDEILQPERQDLEVFVDGINNIVET
QQRVAQQYLEDGSIEDACPPLYALLHIMADGHYQGKDAHHPEIRAMFTRDYLLASDWYRE
RLHIKQQREIALWQRHVDYLGGFLEESSHQTLIDELKLVERHRQAQQKLAELASSAYLES
LVGTLGADPLAPYTTGAV
NT seq 3477 nt   +upstreamnt  +downstreamnt
atggataagctaagggcgctgggtctcgggccggttgggcaagacgaacaagttgttaag
caacagttgcatctttatatcaatctgaaactggcttcgtgcgggcagccgacttgtatc
gataccgggtcggcgcagtttatggataccgcccaggacttgctcaacagctacctggaa
aaaagccggctactggccagttcctccctgtaccccgccgataggcgtattcaagatttc
ctggagcgttattgcgcggatttgggcttagccaaaatccccagtttgccgaccatgacc
ttcgagctggataagcatggcgttgcgcgcgaattgtcactacccctgggcgaagaagaa
ttccgttccgaaatcgtttccagcttccgggttaaacaaggtattttgcataaccctgcc
agcgaccggcgtaccacgcaaggctcgtttcatgttgccgaaggcggcttgccggtgcct
ggcgacaagaagcaggtgcccaagctgacctttgccttgatgctgggcgaggcgctcaat
ccgccggacgatttgatggttctgccgtttaccgcccaccaacccaagccggcgcggatg
tttgcgtcgctattgatgcggccggtagtctgtccggaaattccgggtgtcgccgccgaa
aaatccatggaaattcgcttctttgcgccgggtaatctggtcagcaatctggatttcgtc
gagagtatattcggcaacggcggtaatccggccttgccggaatgcgatgcggccctggat
gtcgagcattggtccggccacagcggttgcgtgattttggcgccgcatttaaccaagctc
actaagaagcagctcggcttgccgcattgggacgaagccagcgatcgccagcgtgccgac
ggcatgtgctggcaaggtccggcggagttgtataacgaaggccaggcctttaaactcacc
gcccgtgaccgcagtggtgtgatcgtcaccttgctggccgacaactattacggttattgc
aagaaggaagtcaaaacccaaatcagctatgccgctaatttgttcggcttggcggaagag
gaacatgccggcggcgcgctggcgtttcgccgcatcaatcacggcgatgagttcggtatc
ggcagcttgacccgcgaaccgggctacgatttcgacgagatgacctatcactacggcgcg
atcatggacgtgcatccggaaggctatgcagtggataggcattttccggaaattatctac
gtcccgcaggatttgcggatgagtctggcaacgcaaaaaattacctggatcagaaacggc
caaagccacagtattcgtttgcaaccgggcaaaatttatgtacagcccaacggttataaa
atcgagatgtgcaagcatcccggtgcgccgtcctggcgcttggtcggcaccgtcgcggaa
ggtactttttgccacaagccctgtacggtgtccggcggtggcaaatcggagatttccaaa
tccatcgaggacgcggcgatctacggaccgctgtttgtggacgatttgcagcacgatctg
gatcgggtgcaggcgattttcgataaagactataccggccgtttcttgccggggttcgag
cgcgaagaccgcggccccagccggaccgtgctcagttcggagcgcagcctgggttcggtg
atcaagttgttgacgccgtctcccaatcacactcgggaattcaacgactggctgcggtcc
attccgcccagcatcttggctttggtgtttttgatcaagcgcttttaccggccggaatgg
ggtaataactggcgcgacaatttatcggtggacgtgatcgacggcgcaccgggacatgag
ttgaaactgaaccagcgtaagatcgttgccacttatttacgggtaggtttcgatctggac
ggcggctggcgcaccttcaaagtgcggcaagactatattgcctgcgagaaagtgcagatg
gaagacgatatcagcgcctcggtcgtggtgccgaccgaggcggtgcgcgcctggctgcca
gacgagggttatgaaatgagcctgaaactggtcagcaactgcgaatatcggctgttccag
cgcccggacgatgcaattattcccggttacgacaagcagaccgagctgaacatgtccggc
cccggcaatttcatggccaatttcgagcctttggatcatgagcagttgtcggcgatcgtg
gaagatgtgatgactttttccaaattcaccgcgccgatgcaaaagctgttaactgacgct
tatcaggatggaaagggctttgtggtgtgttccgcgcatccgcgtctggtgaacggcaag
ccgtcgaaaaacccgcgttacctggaaacccgcgtcgatgttgtcaaacccttacgcaaa
tatgtggccgaactgggcgcgcgcttgcatcgcaagattccgctcaatcaaccgctctgc
catccggtggatgcggtattgaccgggcgccgcaacaatccacccgaaccgggcatccgc
gcgctggcggtttacaatccgattcattatcaagagttgccggaactgttcatggacttt
gtttgttccttgaccggcaagtcgccgtctacgactggtgcgggcagcgaaggcgcgctg
accaaggggccgtttaatgccttgcgcggcaccgccgatctgaataatgcgttggtatcg
ttcattttgaccggctatcccggcttttccagctcggccgggtttatcggtccggatacc
cgcgtcgatcacgacatcagtttgttgattccggagatctgggcgcggctgtcgcgggaa
gaacgccacccggcatttctgttggaacatggctatctggaaccgttaaacgacttcgaa
cacaagggacaaatcgtcttggccagtcgcttgggttatcgcatcaccagtcatttcgtg
catggtttgatgggcaagattttcgataatccgtatgcggtatttaccgacgagatcttg
cagcccgagcgccaggatctggaggtgtttgtggatggcatcaataatatcgtcgaaacc
cagcagcgcgttgctcagcaatatctcgaagacggcagcatagaagacgcctgtccgccg
ctgtatgccttgctgcatatcatggccgacggccactatcagggcaaggatgcgcatcat
ccggagattcgggccatgtttacccgcgattatttactggcttcggattggtatcgggaa
cggctgcatatcaagcagcagcgcgaaattgccttatggcagcgacatgtcgattattta
ggcggcttcttggaagaaagcagtcaccagactttgatcgacgagctgaagttggtcgag
cggcatcgccaggcgcagcagaaattggcggaactggcctcgtcggcttatttagaatcc
ttggtcggtaccttaggagctgatccgctggcaccatacaccaccggcgcggtttaa

DBGET integrated database retrieval system