KEGG   Methylomonas denitrificans: JT25_016965Help
Entry
JT25_016965       CDS       T04191                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JT25_016965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdn01003]
    JT25_016965
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mdn01011]
    JT25_016965
Enzymes [BR:mdn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     JT25_016965
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     JT25_016965
Glycosyltransferases [BR:mdn01003]
 Polysaccharide
  Bacterial polysaccharide
   JT25_016965
Peptidoglycan biosynthesis and degradation proteins [BR:mdn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   JT25_016965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AMK78153
UniProt: A0A126T7T2
LinkDB All DBs
Position
complement(3676675..3679002)
Genome map
AA seq 775 aa AA seqDB search
MARRPRSSKSTVRRRKSQPQASWLKRSLVSLLLIGAFVLAAYVSYLDYTVREQFEGKRWS
IPARVYASPVELYAGYEISSKNLEDLLLELHYRQDYQLAGEGSYYVKGGQINIRTRAFNF
GNTPQESRKISVSFTSGGIASITDAGTGESLAIVRMDPVQIGSFYPTRKEDRILIKLDEA
PQTLVQGLLSTEDKDFYNHFGISPKGIVRAMWSNVKAGGMVQGGSTITQQLVKNFFLNPK
RTLRRKLKEALMSFILEYRYSKDEILEAYLNEIFLGQDGASAVHGFGLASEFYFGQSLKT
LNLHQVATLVALVRGPSEYDPRRNPEHTLERRNIVLDAMHTEGFIDAQQVSEAKKQPLGV
ATVIHRSANRYPGFIDLVKRQLKQEYKEDDLTSEGLRIVTTLDTRIQDTLEKSIASKLKH
LEKSPKSNDLETAAIVTRRDSGEIVALAGGRDAEDTGFNRALDAVRPIGSLIKPVVYLTA
LEYPDRYTIATPISDTRLEIPAERGKTWSPDNYDNQEHGVVPLHSALAHSYNMATVRIGM
DIGLAKVANTLKSMGVSRPVDLFPSFLLGAQPLTPLEVTQLYQTLAGDGYATPLRSIRAV
NAADGKALQSYPFTVRQAVDPAASFITNTILQEVMYAGTGHSAYNYMPQNMALVGKTGTT
NQLRDSWFAGFSGDFLSVVWVGRDDNKPTGLTGGTGALQIWSELMRQVSKKPVSLVPPDN
VQMTWIDPASGLLSNEGCPGAKLMPFVDGSAPSQFADCGASPESGESWLNNLNPF
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgacccagaagcagcaaatcgaccgttagacgcagaaaatcacaaccccaa
gcatcatggctgaaacgctcgcttgtttcgctgctattaatcggggcttttgtattggcg
gcttatgtcagctacctcgattacaccgtgcgcgagcaattcgaaggcaagcgctggtcc
attccggcccgcgtgtatgccagccctgtcgagttgtacgccggttacgaaatttccagc
aaaaacctggaagacttattgctggaattgcattatcgccaggattatcaattggccggc
gaaggctcttattacgtcaagggcggccagatcaacatccgtacccgcgccttcaatttt
ggcaacacaccccaggaaagccgcaaaatcagcgttagcttcactagcggcggcatcgcc
agcattactgacgcaggcaccggcgagagtttggccatcgtgcgcatggacccggtgcaa
atcggcagtttttacccgactcgtaaggaagaccggattctaatcaagttggacgaagcg
ccgcaaaccctggtgcaaggcctgttgtctaccgaagataaggacttttacaaccatttc
ggcatctcgcccaagggcatcgtccgcgccatgtggtcgaacgtgaaagccggcggcatg
gtgcaaggcggcagtaccatcacccagcagttggtgaaaaactttttcctgaatcccaaa
cgtacgctgcgccgcaagctcaaggaagctttgatgtcgtttattctggaatatcgctac
agcaaggatgaaattctggaagcctatctcaacgaaatattcctgggccaggacggcgcc
agcgcggtacatggctttggcttggccagcgagttttattttggtcaatctttaaaaacc
ctgaacctgcatcaagtcgccaccttggtagctttggtgcgcggaccgtccgaatacgat
ccacgccgcaatcccgagcacaccctggagcgccgcaacatcgtgctggatgcgatgcac
acggaaggttttatcgacgcacagcaagtgagcgaagcgaaaaaacagccgctgggggtt
gccacggtcattcatcgttccgccaaccgctatccgggttttatcgatttggtcaaacgg
caactgaaacaggaatataaagaagacgatctgacctcggaaggcttgcgcatcgtcacg
actttggacacccgcatccaggacacgctggaaaaatccatcgccagcaaactgaaacat
ttggagaaaagcccgaaaagcaacgatctagaaaccgctgccatcgttacccgtcgcgac
agcggcgagattgtcgcactggccggcggccgcgatgccgaggatactggctttaaccgc
gcattggacgcggtaaggccgataggctcgttgatcaaaccggtggtttatttgaccgcg
ctggaatatccggatcgctacaccatcgccacgccgatcagcgacacccgcctggaaatt
ccggccgaaagaggcaaaacctggtcgccggacaactacgacaatcaggaacacggcgtg
gtgccgctgcatagcgctttggcccactcctataacatggcgacggtgcggatcggtatg
gacattggcttggccaaagtcgccaataccctaaaaagcatgggtgtcagccggccggtg
gatttgtttccatccttcctgctgggcgcgcaaccgctgacgccgctggaagttacgcag
ttgtatcaaaccctggccggcgacggctatgcaacgccgttgcgttcgatccgcgcggta
aacgccgccgacggcaaagccctgcaaagttatccgtttaccgtgcgtcaagccgtcgat
ccggccgccagctttatcaccaacaccattttgcaggaagtgatgtacgccggcaccggc
cattccgcgtataactatatgccgcaaaacatggccttggtcggtaaaaccggcaccacc
aatcaattgcgcgacagctggtttgccggctttagcggcgattttctgtccgtggtctgg
gttggccgcgacgacaataaaccgaccggcttgaccggcggaaccggcgccctacaaatc
tggtccgagctgatgcggcaagtgtcgaaaaagccggtcagcctggtaccgcccgataat
gtgcagatgacctggatagacccggccagcggcttgctcagtaatgagggctgccccggc
gctaaattgatgcctttcgtggacggatcggcgcccagccaatttgccgactgcggagca
agtccggaatccggcgaaagctggcttaataacctgaaccctttttaa

DBGET integrated database retrieval system