KEGG   Methylomonas denitrificans: JT25_017110Help
Entry
JT25_017110       CDS       T04191                                 

Definition
(GenBank) 3-mercaptopyruvate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn00270  Cysteine and methionine metabolism
mdn00920  Sulfur metabolism
mdn01100  Metabolic pathways
mdn01120  Microbial metabolism in diverse environments
mdn04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    JT25_017110
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    JT25_017110
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    JT25_017110
Enzymes [BR:mdn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     JT25_017110
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     JT25_017110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: AMK78182
UniProt: A0A126T7Y4
LinkDB All DBs
Position
complement(3705321..3706166)
Genome map
AA seq 281 aa AA seqDB search
MSYTTLVSADILAANLNNPDWRIFDCRFSLADVTAGHKSYRQGHIPGARYVDLNRDLSSP
VQSYTGRHPLPNFSLLGKKLGDWGVNNRCQIVVYDDAGGAFAGRMWWLLRTMGHTQVAVL
DGGFGYWQKQGLPVTTTLPKITASQFRVYLDNQQWMDAAQVTDSLAARKITLIDARTPER
FHGQQEPIDPVAGHVPKALNRPLPTNLDKSGRFLTAELLHQQFSKLIAAYPAEQVVHMCG
SGVTACHNLLAMEIAGLSGSKLYAGSWSEWITNRNRPVATD
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaccacactggtttccgcagacattttagctgctaacctgaacaacccggat
tggcgaatattcgactgccgcttttctctagccgatgtaacggccggccacaaatcctac
cgacaaggccatattccgggcgctcgctatgtcgatttaaaccgggatttgtcctcgcca
gtgcaatcctataccggccgccacccattacccaatttttcattattaggcaaaaaactg
ggtgactggggcgttaacaaccgctgtcaaatcgtggtgtatgacgatgccggcggcgcg
tttgccggccggatgtggtggctgctgcgcactatgggccatactcaagtcgcagtgttg
gatggcggatttgggtattggcaaaaacaaggcttgccggtcactaccacactaccgaaa
attaccgctagccaatttcgcgtctatctggacaatcagcaatggatggatgccgctcaa
gtaacggacagtttggcggcccgaaaaatcacgctgatagacgcaagaacaccggaacgc
ttccatggtcaacaagagccgatagaccctgtcgcaggccacgtacctaaagctctaaac
cggccattaccaactaatctggacaaatccggacgatttttaacagccgagctgttgcac
cagcaatttagcaaactgatagctgcttaccctgccgagcaggtggttcatatgtgtggc
tccggcgtgacagcctgccacaacctgttagcgatggaaattgcaggactaagtggttcg
aaactttacgccggctcgtggagcgaatggattaccaaccggaatcggcccgtcgcaacg
gattga

DBGET integrated database retrieval system