KEGG   Methylomonas denitrificans: JT25_017115Help
Entry
JT25_017115       CDS       T04191                                 

Definition
(GenBank) NAD(P)H-quinone oxidoreductase
  KO
K00344  NADPH:quinone reductase [EC:1.6.5.5]
Organism
mdn  Methylomonas denitrificans
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JT25_017115
Enzymes [BR:mdn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     JT25_017115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N AlaDh_PNT_C ADH_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMK78183
UniProt: A0A126T7W2
LinkDB All DBs
Position
complement(3706169..3707146)
Genome map
AA seq 325 aa AA seqDB search
MRAIEIYRPAELADLIITDQPLPSPAAHQVLIKVVAAGVNRPDLMQRKGLYPPPPGASAV
LGLEVSGIIEAIGSEVTEFTAGDPVCALLTGGGYAEYCLTSASCCLPIPKGLSFIQAAAL
PETFFTVWSNLFDRAKLQAGESLLVHGGTSGIGTTAIQIGKAFGSRVIVTAGSEEKCQYC
QKLGADLAINYRQQDFVAAVLHHTDNRGVDVVLDIIGGDYLPRNLKCLAIDGRLQQIAIQ
HGGKSEINLASVLMKRLTISGTTLRPRSDDFKAKIARQLFAKVWPLLEAGQLEPIIDSVF
PLTKAAEAHERMESSQHIGKIILEI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatcgagatttatcgtcccgccgaacttgccgatttaatcataacggaccaa
ccgctaccctctcccgctgcgcatcaagtgttgataaaagtagtcgcagcaggagtaaac
cgccccgacctgatgcagcgcaaaggcttgtatccaccgccgccaggtgcatccgccgtt
ctcggattggaagtatccggcattatcgaagcaattgggagcgaagtaactgaatttaca
gctggcgacccggtttgcgccctgctgacgggcggcggttatgcagagtattgcctgaca
agcgccagttgctgtctgcccataccgaaaggcttgagttttattcaagccgccgcgtta
ccggaaactttttttacggtctggagcaatcttttcgaccgcgcgaaactacaagccggg
gaaagcttgttggtacatggcggtaccagcggtatcggcaccaccgccattcaaatcggc
aaagccttcggcagccgcgtcatcgttaccgccggcagcgaggaaaaatgtcagtactgc
caaaaattaggcgctgatctggcgattaattatcggcaacaagactttgtcgcggctgtt
ttacatcataccgacaacagaggcgtcgacgtggttttagacataatcggtggcgattat
ttgccccgcaacttgaaatgcctggctatcgatggccgactacaacagatcgccatccaa
cacggcggcaagagcgaaatcaatttagcgtccgtgctgatgaaacgactaaccatttcc
ggcacgaccttgcgtccccgcagcgacgatttcaaggctaaaatagcccgacaacttttt
gcaaaagtctggccgctactggaagccggccaactcgaacccatcatcgattcggttttt
ccgcttaccaaggccgctgaagctcacgaacgcatggaaagcagccaacatatcggtaaa
attattttggagatataa

DBGET integrated database retrieval system