KEGG   Methylomonas denitrificans: JT25_017120Help
Entry
JT25_017120       CDS       T04191                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn00220  Arginine biosynthesis
mdn01100  Metabolic pathways
mdn01110  Biosynthesis of secondary metabolites
mdn01210  2-Oxocarboxylic acid metabolism
mdn01230  Biosynthesis of amino acids
Module
mdn_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    JT25_017120
Enzymes [BR:mdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     JT25_017120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AMK78184
UniProt: A0A126T8T6
LinkDB All DBs
Position
3707225..3708253
Genome map
AA seq 342 aa AA seqDB search
MIRAGIVGGTGYTGVELLRILVLHPQVEVSVVTSRADAGLRVDQLYPSLRGYCDVKFTLP
ELDNLKDCDVVFFATPNGTAMLMAESLLALGIKVIDLSADFRIKDRQEWEKWYGMQHACP
DLIAEAVYGLPEVNREQIKPARLIACPGCYPTAVQLGFLPLLEAGVIDGSQLIADVKSGV
SGAGRKAEISSLMSETGESFKAYAVGGHRHLPEITQGLQNVAKQAVGLTFVPHLTPMIRG
IHATLYARLNRKLDLQSLFEERYSEERFVDVLPNGIHVDTRNVRGSNRCQIAVNQPQGGD
TVVILSVIDNLVKGASGQAVQNMNLVFGLDECQGLETVALYP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtgcaggcattgtcggcggtaccgggtacaccggcgtcgaattgttaagaatt
ttggtgttacatccccaggtcgaagttagcgtagtgacttctcgcgcggatgccggactg
cgagtggatcagttgtatccgagtctgcgaggctactgcgatgtgaaatttaccctgccg
gagttggataatttaaaagactgcgatgtggtgtttttcgcgacgccaaacggcaccgcc
atgctgatggctgagtcattgctggctctgggtatcaaagttatcgatttgtctgccgat
ttccggattaaagatcggcaggaatgggaaaagtggtatggcatgcagcacgcctgtccg
gatttgatcgccgaagctgtatatggtttgccggaagtcaatcgcgagcagatcaagccg
gcacgtttgatcgcatgccctggatgttatccgactgccgtgcagctggggtttttgcct
ttgctagaagcgggagtgattgatggtagccagttgatcgccgatgtaaaatccggtgtc
agcggagccgggcgcaaggcggaaatttcttctttgatgagtgagaccggcgagagtttt
aaggcctatgcggtcggcgggcatagacatttgccggaaattactcagggtttgcaaaat
gttgccaagcaggcggttgggctaactttcgtgccgcatctgacgccgatgatacgcggt
attcacgccacgctttatgcgcgtttaaaccggaagctggatttgcaaagtctgtttgaa
gagaggtatagcgaagaaagatttgtggatgtgttgccgaatggcattcatgtcgacact
cgtaacgtgcggggcagcaatcggtgtcagattgcggtaaatcagccgcaaggcggcgat
actgtggtgattttgtcggtgattgataacttggttaaaggtgcgtcaggccaagcagtg
caaaatatgaatctggtttttgggctggatgaatgccaaggtttagaaaccgtggctctt
tatccctag

DBGET integrated database retrieval system