KEGG   Monodelphis domestica (opossum): 100009833Help
Entry
100009833         CDS       T01031                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
mdo04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100009833 (MGAM)
   00500 Starch and sucrose metabolism
    100009833 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100009833 (MGAM)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100009833 (MGAM)
    3.2.1.20  alpha-glucosidase
     100009833 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100009833
NCBI-ProteinID: XP_016281681
LinkDB All DBs
Position
8
AA seq 3628 aa AA seqDB search
MGKKNFSKLEIILSFLLFILFIISVALIVILATNTSSVNDGSFVNTTSSPQTTIASSIVN
STTTSQTTTIAAECPAANQSERINCIPDQTPTQTTCSQRGCCWSPQGPENIPLCYFPKKY
GYQIRNSTYSRTGFTAHLNRLPTPSMFGNDIANVILTAEYQTANRFHFKISDPSEARYEV
PHEHVQLFPGNATSNLNYHVDCVEEPFSIKVTRKSNNRVLFDTGIGPLQFAQQYLQLSIQ
LPSANVYGLGEHVHQQYRHDMDWKTWPIFSRDTTPNEDMTNLYGAQTFFLCLEDTSGASF
GVFLMNSNAMEVTLQPAPAITYRVIGGVLDFYVFLGNTPEEVVREYLELIGRPFLPSYWS
LGFHLSRWVYGGLDGMKKVVERNRAAQLPCDVQYSDIDYMDEKKDFTYDKVLFNGLPEFV
EDLHNHGQKYVIIMDPAIFINSSNYGPYIRGSDMKIWVNASDGVTPLIGMVWPGQTVFPD
YTNPKCAQWWAEEFRLFYRELKFDGIWIDMNEPSNFENGSSIGCSHNTLNSPPFIPRILD
RYLPSKTLCMDAVQHWGKHYDVHSLYGYSMAIATEEAVKTVFPNKRSFIVTRSTFAGSGK
FAAHWLGDNAATWNDLRWSLPGMLEFNLFGIPMVGPDICGFTYNVSEELCRRWMQLGAFY
PFSRNHNGEGYKDQDPAAFGKDSLLLNSSRHYLNIRYTLLPYLYTLFFRAHTRGDTVARP
LLHEFYEDSNTWAVYRQFLWGPGLLITPVLDEGAKNVTAYLPDAVWYDYETGGQIPERKQ
QVEMLFSPEQIGLHLRGGYIFPIQQPAITTVASRKNPLGLIIAPDDNKEARGELFWDDGE
TKGTIASGSYILHEFLFTQNRLDMKVLHQSYNDPNNLAFEEIKILGTEEPTNITVKKNNV
PIASSPNVTYFEKDRVAMISGLELALGEEYTVEWSIKFREVIKIDCYPEDQAVSEENCTA
RGCAWELSNSPGVPNCYVINHLYSVSSIQYNPTGITADIFLNSPVRASNLLSAGLSTPVN
PLRLDVTYHKNDMLQFKIYAANSKRFEVPVPLNIPSSPSSTAENRLYEVLIKRDPFGIEI
RRRSTGTIIWDSQIPGFTFNDMFLRISTRLPSQYVYGFGETEHTTFRRNLTWHTWGMFSR
DQPPEYKKNSYGVHPYYMGLEDDGKAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYM
VLGPTPELVTQQYTELVGRPVMTPYWALGFQLCRYGYQNDAEIAELYDAMVAAQIPYDIQ
YSDIDYMERQLDFVLSSKFAGFPDLINRMKEAGMRVILILDPAISGNETQPYPPFLRGVE
DDVFIKWPDDNGIVWVKVWPDLPNVTVNTSLDWDTQVELYRAHVAFPDFFRNSTVKWWKR
ELLELYNNPQEPEKSLKYDGLWIDMNEPSSFVNGAVSPGCRNTTLNHPPYMPYLEARDRG
LSSKTLCMESQQFLPDGSPVTHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSS
GRWAGHWLGDNKSTWDQLYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGA
FYPFSRNHNALGTKRQDPVAWNSTFEDLSRSVLKTRYTLLPYLYTLMHKAHVEGSTVVRP
LLHEFIEDKETWDIFLQFLWGPAFLVSPVLEPNSRQVSAYFPRARWYDYYSGSDIGVRGQ
WKDLSAPLDHINLHIRGGYILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFWDDGE
SIDTYEKGNYYFSTFSASEKHLDVKVFQQNYQDPNHLAFKEIKIFGLNFQPFLVTVKENN
IPIQSDAEIKYDPATKVTHITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQEEKCK
LRDCVWEPTNSTGVPFCYITKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQLRLD
VTFHKNHMLQFKIYDANNKRYEVPVPLNTPNSPTSQPENRLYEVTIKENPFGIEIRRKST
GTVIWDSQVPGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRDLNWHTWGMFSRDQPPG
YKKNSYGVHPYYMGLEEDSNAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPT
PELVTQQYTELIGRPVMTPYWALGFQLCRYGYENDNEIAELYDAMVAAQIPYDVQYSDID
YMERQLDFTLSPKFAGFPDLISRMKDAGMRVILILDPAISGNETKPYPAFTQGVQQDVFI
KWPNEDSIVWGKVWPDLPNVTINGSLDWDTQVELYRAHVAFPDFFRNSTVQWWKQELREL
HTNSREPEKSLKFDGMWIDMNEPSSFVNGAVPPGCRNDTLNHPPYMPHLESRDRGLSSKT
LCMESQQILPDGSPVRHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAG
HWLGDNTAAWDQMYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWTQLGAFYPFS
RNHNTIGPRRQDPVSWNSTFEDLSRDVLNIRYTLLPYLYTLMHKANVEGSTVVRPLLHEF
VEDKETWDLFHQFLWGPAFLISPVLEHNARNVNAYFPNARWYDYYTGSDIGVRGQWKDLS
APLDYINLHIRGGYILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFWDDGESIDTY
EKGNYYFSTFSASEKHLDVKVFQQNYQDPNNLAFKEIKIFGLNFQPLLVTVKENNIPIQS
DAEIKYNPATKVTHITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQEEKCKLRDCV
WEPTNSTGVPFCYITKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQLRLDVTFHK
NHMLQFKIYDANNKRYEVPVPLNTPNSPTSQPENRLYEVAIKENPFGIEIRRKSTGTVIW
DSQVPGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRDLNWHTWGMFSRDQPPGYKKNS
YGVHPYYMGLEEDSNAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVT
QQYTELIGRPVMTPYWALGFQLCRYGYENDNEIAELYDAMVAAQIPYDVQYSDIDYMERQ
LDFTLSPKFAGFPDLISRMKGAGMRVILILDPAISGNETKPYPAFTQGVQQDVFIKWPDE
DSIVWGKVWPDLPNVTINGSLDWDTQVELYRAHVAFPDFFRNSTVQWWKKELRELHNNSR
EPEKSLKFDGMWIDMNEPSSFVNGAVPPGCRNDTLNHPPYMPHLESRDRGLSSKTLCMES
QQILPDGSPVRHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAGHWLGD
NTAAWDQMYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWTQLGAFYPFSRNHNT
IGPRRQDPVSWNSTFEDLSRDVLNIRYTLLPYLYTLMHKANVEGSTVVRPLLHEFVEDKE
TWDLFRQFLWGPAFLISPVLEHNARNVNAYFPNARWYDYYTGEDIGVRKQYKELSAPLDH
INLHVRGGYILPWQEPAINTRYSREKFMGLTVALDDEGNAKGCLFWDDGESINTYENGDY
YFANFSARPNNLEHHIIHNKYIVATKPLWLGFIHIWGLSIDSITNVTVAQKEHVLTIDNF
QHDQARQILAVNLTAHQITLGHPFVVTW
NT seq 10887 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagaattttagcaagttggagataatcctctcttttctgctcttcatatta
ttcatcatctctgttgctctgattgtgattttagctacaaatacttcaagtgtgaatgat
ggctcatttgttaacactacttcaagtcctcagacaacaatagcctcttcaattgtgaat
tctactaccacctcccaaactaccacaattgcagcagaatgccctgcagcaaaccaatca
gaaaggatcaactgcatcccagatcaaacaccaacacagactacgtgttcccagcgtggc
tgctgctggagcccccaaggaccagaaaatatacccttgtgctacttccccaagaagtat
ggctatcagataagaaatagtacatactccaggacagggttcactgctcatttgaacaga
ttgcctaccccatcgatgtttggaaatgatattgccaatgtcatccttacagcagaatac
cagacagccaaccgtttccacttcaagatcagtgaccccagtgaagccagatatgaggta
cctcatgaacacgtccaactgtttcctggaaatgcaacttctaatttgaactatcatgtg
gattgtgttgaggagccatttagcatcaaagttacccggaaaagcaacaatcgtgtttta
tttgacactggtattggacccctccagtttgctcagcaatacttgcagctctctatccag
ttaccaagtgctaatgtgtatggcttaggggagcatgtacaccagcaatatcgtcatgac
atggactggaagacttggcccatcttctctcgggatactactcctaatgaagacatgact
aacttgtatggtgctcaaacatttttcttgtgccttgaagatacaagtggagcatccttt
ggggtttttctgatgaacagcaatgccatggaggttacccttcaacctgccccagcaatc
acttaccgagtcattgggggtgttctggatttttatgtcttcttagggaacactccagaa
gaggttgttcgggaatatttagagctcattggaaggccattcttgccatcttactggagt
cttggatttcatctcagtcgctgggtatatggaggtttggatgggatgaagaaagtcgta
gagagaaaccgagctgctcaacttccctgtgatgttcagtactctgatattgactacatg
gatgaaaagaaggacttcacttatgataaagtactatttaatggacttcctgagtttgtt
gaggatttacacaaccatggacagaaatatgtaattattatggatccagccattttcatt
aactcttccaactatggtccttacattcggggctcagacatgaagatatgggtcaatgca
tcagatggagtgacgccactaattgggatggtgtggccaggccagaccgtctttcctgac
tataccaatccgaagtgcgctcagtggtgggcagaggagttcagactcttctacagggag
ttaaagtttgatggaatctggattgatatgaatgaaccctccaactttgaaaatggttca
tctataggatgctcacataataccctgaactctcccccattcattcctagaatactggac
agatacctgccttccaagaccctttgcatggatgcagtacagcactggggcaaacattac
gatgtccacagtctgtatggctactcaatggccattgcaactgaagaagctgtaaaaact
gtcttccctaataaaagaagctttattgtgacacgctctacctttgctggatcgggcaaa
tttgcagcccattggctgggggacaacgcagccacttggaatgaccttcgttggtctcta
cctggcatgctcgaattcaacctgtttggtattcctatggttggccctgacatctgtggt
tttacctataatgtctcagaagaactatgcaggcggtggatgcagcttggggcattttat
ccattttccaggaatcacaacggtgaaggctacaaggaccaggatcctgctgcatttgga
aaagattcccttcttttgaattcctccagacactacctgaacatccgctatactctgctc
ccctatctctacaccctttttttccgagctcacactcggggggacactgtagcccggccc
cttcttcatgagttctatgaagatagtaacacctgggctgtgtatcggcagtttctgtgg
ggtcctgggcttctcattactcctgttctggatgagggtgctaagaatgtgacagcatac
ctgcctgatgctgtctggtatgactatgaaactggaggccaaataccagagagaaaacaa
caggtggaaatgctattctcaccagaacaaattggactccatcttcgaggtggctatatt
ttccccatccagcaaccagccataaccacagtagccagccgaaagaatcctcttggtctc
atcattgcccctgatgacaataaggaagctagaggagagcttttttgggatgatggggaa
actaaaggtacaatagctagtggttcctacatcttgcatgagtttttgttcacccaaaac
cgtttggatatgaaggttttgcatcaatcctacaatgatccaaataatttagcatttgaa
gagattaaaatcctcgggacagaagaacctaccaacatcactgtgaagaagaataatgtc
cccattgcatcttctcctaatgtcacttactttgaaaaggaccgggttgctatgatctca
ggacttgaacttgccctgggagaagaatacactgtggaatggagtataaaattcagagag
gtcatcaaaatagactgttatcctgaggaccaggcagtctctgaagaaaattgcacagcg
cgtggctgtgcctgggagttatctaattctccaggagtccctaactgctatgtcatcaat
cacctatattctgtcagtagcattcagtacaacccaacagggatcactgcagatatcttc
ttaaattcacctgtgcgtgcttccaacctgctctctgctgggctctctactcctgtgaac
cctctccgcttggatgtcacctaccataagaatgatatgctgcagtttaagatctatgct
gccaatagcaaaaggtttgaggtccccgtgcctctcaacatccccagctctccctctagc
accgctgagaatcggctttatgaagttctcataaagagggatccctttgggattgagatc
cgacgtcggagcacaggcacaataatttgggattcacagattcctggcttcacctttaat
gacatgttcctgcgaatctctacccgcctcccatcccagtatgtctatggctttggggag
acagaacacaccaccttccggagaaacttgacctggcatacgtggggaatgtttagtcga
gaccaacccccagaatacaagaagaattcctatggtgtacatccctattatatgggtctg
gaggatgatggcaaagcgcatggagtgctactactcaatagcaatgccatggatgtgact
tttcagcccactcctgcactgacatatcgcaccactgggggaattctggacttctatatg
gttttgggaccaaccccagaactcgtcactcagcagtacacagagttggttgggcggcca
gtgatgacaccttactgggccttagggttccagctttgtcgttatggataccaaaatgat
gctgaaattgctgaactttatgatgctatggtggcagcccagatcccttacgatatacag
tattcagacattgattacatggaacggcagttagacttcgtcctcagctccaagtttgct
ggctttcctgatctgatcaatcgaatgaaggaagctgggatgagagtcatcctgattctg
gacccggccatttctggcaatgagacccagccatatcctccattccttcggggggtcgag
gatgatgtgttcattaaatggccagatgacaatggaattgtttgggtaaaggtctggcca
gatttgcccaatgtcactgttaatacatctcttgattgggacactcaagtggagttatac
agagctcatgttgccttcccagactttttccgtaattcaacagtcaagtggtggaagcgg
gaattgctggaactctacaacaatccccaggagccagagaagagtctgaagtatgatgga
ctgtggattgacatgaatgaaccgtcaagctttgtgaatggagcagtttctccaggttgc
aggaataccacactcaaccaccctccctatatgccctatttggaggcaagagatagaggt
ctgagcagcaaaaccctgtgcatggaaagtcagcaattcctgcctgatggaagtccagtg
acacactatgatgtgcataatctctatggctggtcccagacgaagccgacatatgaagga
gttcaggaggctacaggaaagagaggaattgtgatcagtcgctcaactttcccttcttct
ggacgctgggcaggacactggctgggagacaacaaatcaacatgggaccaactctataag
tccatcattggcatgatggagttcagtctctttggaatatcctatacaggagctgatatt
tgtgggttctttcaagatgctgaatatgaaatgtgtgctcgatggatgcaactgggagcc
ttttacccattctctaggaaccacaatgctcttgggaccaagaggcaggacccagtggct
tggaattctacctttgaggatctctcaagaagtgtccttaagacaagatataccctcttg
ccatatctctacaccctcatgcacaaggctcatgttgaaggcagcacagttgtccgaccc
cttctccatgagtttatagaagacaaagaaacctgggacattttccttcagttcttgtgg
ggaccagccttcctagtcagtcctgtcctcgaacctaattccaggcaagtgtctgcctac
ttccccagagctcgttggtatgattactactcgggctcagatattggagtgaggggacag
tggaaggatctgtcagctcctcttgaccacatcaatctccatattcgtggaggctacatc
cttccatggcaagaacctgctaataatactcattatagccggagaaactccttgggtctt
cttgtggctttatcagataatggaacagctgaaggagagtttttctgggatgatggagag
agtattgatacctatgaaaaggggaattactatttctcaacattctctgccagtgagaaa
cacctggatgtgaaggtttttcagcagaattaccaagatccaaatcacctggcatttaaa
gagataaaaatctttggactgaatttccagccatttctagttactgtgaaagagaataat
attccaatccagtctgatgctgagataaagtatgatcctgcaacaaaggtcactcacatc
actagacttaaccttgagctggggaaagagtatacagtggagtggtccacaaagttcaga
gacacagaaaaatttgactgctacccagatgcagatggtgctcaggaagagaaatgtaaa
ttacgtgactgtgtctgggagccaaccaattctacaggagtccccttttgctacatcact
aagtattattatactgccagtaacattcagaatacaggagtgggcctaacagcagacatc
tcccgaaatgcagaagtcaatcactatccttccacacccattaaccagctccgattggat
gtgacattccataaaaatcacatgctacagtttaagatctatgatgccaacaacaagaga
tatgaagtcccagtgcccttaaatactccaaactcccccaccagtcaacctgaaaatcgt
ctctatgaggtgaccatcaaggaaaacccatttggaattgagatccgccgaaaaagcacg
ggcactgtgatctgggattcccaggtccctggctttacctttaatgatatgttcctacga
atctccacccgcctcccatcacactacatctatggctttggagaaacagagcacacgacc
ttcaggagggatctaaactggcacacttggggaatgttttctcgagaccagcctccaggc
tacaagaagaattcctatggtgtacacccatattacatgggtctggaagaggacagcaat
gcccatggagtgctcctgctcaacagcaatgccatggatgtaactttccaaccaacccct
gcactcacatatcggaccatcggaggtattctggacttttacatggttttgggacctacc
ccagagctcgttactcagcagtacacagagttgattggccggccagtgatgactccttac
tgggccttaggattccagctgtgtcgttatggatacgagaatgataatgaaattgccgaa
ctctacgatgccatggtggctgctcagatcccctatgatgtgcagtactcagacattgat
tacatggagaggcagctagattttaccctcagtcccaagtttgctggctttcctgatcta
atcagtcgaatgaaggatgctgggatgcgagtcatcctcattctggacccggctatttct
ggcaacgagaccaagccatatcctgccttcactcagggagtccagcaagatgtgttcatt
aaatggcctaatgaagacagcatagtttggggaaaggtctggccagatttgcccaatgtc
actatcaatggatctcttgactgggacacccaagtagagttatacagagctcacgttgcc
ttcccagactttttccgtaattcaacagtccagtggtggaagcaggaattgagggaactg
cacaccaattcccgggagccagagaagagcttgaagtttgatggaatgtggattgacatg
aatgaaccatcaagctttgtgaatggggcagttcctccaggctgcaggaatgacacactc
aatcatcctccttacatgccccatctggagtcaagagacagagggctgagcagtaagacc
ctgtgcatggaaagtcagcagatcctgcctgatggaagtccagtgaggcactacgatgtg
cacaatctctatggctggtcccagacaaagcccacatatgaaggtgtgcaggaggctaca
ggaaagcgaggaattgtgatcagtcgttcaacatttccttcttcaggacgctgggcagga
cattggttgggagacaacacagcagcctgggatcagatgtataaatccatcattggtatg
atggagttcagtctttttggaatatcctatacaggagctgatatctgtgggttctttcaa
gatgctgaatatgagatgtgtgctcgctggacacaactgggagccttttaccctttctct
aggaaccacaataccattgggcctaggagacaagaccccgtatcttggaattccaccttt
gaagatctttcaagagatgtcctaaatataagatacactctgttgccttatctctacact
ctgatgcataaggccaacgtagaaggcagcactgttgtccggcccctccttcatgaattt
gttgaagacaaagaaacttgggacttattccatcaattcttgtggggtccagccttctta
atcagccctgtcctggaacacaatgcccggaatgtgaatgcctacttccccaatgcccgc
tggtatgattactacacgggctcagatattggagtgaggggacagtggaaggatctgtca
gctcctcttgactacatcaatctccatattcgtggaggctacatccttccatggcaagaa
cctgctaataatactcattatagccggagaaactccttgggtcttcttgtggctttatcg
gataatggaacagctgaaggagagtttttctgggatgatggagagagcattgatacctat
gaaaaggggaattactatttctcaacattctctgccagtgagaaacacctggatgtgaag
gtttttcagcagaattaccaagatccaaataacctggcatttaaagagatcaaaatcttt
ggactgaatttccagccacttctagttactgtgaaagagaataatattccaatccagtct
gatgctgagataaagtataatcctgcaacaaaggtcactcacatcactagacttaacctt
gagctggggaaagagtatacagtggagtggtccacaaagttcagagacacagaaaaattt
gactgctacccagatgcagatggtgcccaggaagagaaatgtaaattacgtgactgtgtc
tgggagccaaccaattctacaggagtccccttttgctacatcactaagtattattatact
gccagtaacattcagaatacaggagtgggcctaacagcagacatctcccgaaatgcagaa
gtcaatcactatccttccacacccattaaccagctccgattggatgtgacattccataaa
aatcacatgctacagtttaagatctatgatgccaacaacaagagatatgaagtcccagtg
cccttaaatactccaaactcccccaccagtcaacctgaaaatcgtctctatgaggtggcc
atcaaggaaaacccatttggaattgagatccgccgaaaaagcacgggcactgtgatctgg
gattcccaggtccctggctttacctttaatgatatgttcctacgaatctccacccgcctc
ccatcacactacatctatggctttggagaaacagagcacacgaccttcaggagggatcta
aactggcacacttggggaatgttttctcgagaccagcctccaggctacaagaagaattcc
tatggtgtacacccatattacatgggtctggaagaggacagcaatgcccatggagtgctc
ctgctcaacagcaatgccatggatgtaactttccaaccaacccctgcactcacatatcgg
accatcggaggtattctggacttttacatggttttgggacctaccccagagctcgttact
cagcagtacacagagttgattggccggccagtgatgactccttactgggccttaggattc
cagctgtgtcgttatggatacgagaatgataatgaaattgctgaactctacgatgccatg
gtggctgctcagatcccctatgatgtgcagtactcagacattgattacatggagaggcag
ctagattttaccctcagtcccaagtttgctggctttcctgatctaatcagtcgaatgaag
ggtgctgggatgcgagtcatcctcattctggacccggctatttctggcaacgagaccaag
ccatatcctgccttcactcagggagtccagcaagatgtgttcattaaatggcccgatgaa
gacagcatagtttggggaaaggtctggccagatttgcccaatgtcactatcaatggatct
cttgactgggacacccaagtagagttatacagagctcacgttgccttcccagactttttc
cgtaattcaacagtccagtggtggaagaaggaattgagagaactgcacaacaattcccgg
gagccagagaagagcttgaagtttgatggaatgtggattgacatgaatgaaccatcaagc
tttgtgaatggggcagttcctccaggctgcaggaatgacacactcaatcatcctccttac
atgcctcatctggagtcaagagacagagggctgagcagtaagaccctgtgcatggaaagt
cagcagatcctgcctgatggaagtccagtgaggcactacgatgtgcacaatctctatggc
tggtcccagacaaagcccacatatgaaggtgtgcaggaggctacaggaaagcgaggaatt
gtgatcagtcgttcaacgtttccttcttcaggacgctgggcaggacattggttgggagac
aacacagcagcttgggatcagatgtataaatccatcattggtatgatggagttcagtctt
tttggaatatcctatacaggagctgatatctgtgggttctttcaagatgctgaatatgag
atgtgtgctcgctggacacaactgggagccttttaccctttctctaggaaccacaatacc
attgggcctaggagacaagaccccgtatcttggaattccacctttgaagatctttcaaga
gatgtcctaaatataagatacactctgttgccttatctctacaccctgatgcataaggcc
aatgtagaaggcagcactgttgtccggcctctccttcatgaatttgttgaagacaaagaa
acttgggacttattccgtcaattcttgtggggtccagccttcttaatcagccctgtcctg
gaacacaatgcccggaatgtgaatgcctacttccccaatgcccgctggtatgattactac
acgggagaagatataggagtaaggaaacaatataaggaattatcagctcctcttgaccac
attaatcttcatgtccgtgggggctacatccttccctggcaagaacctgccattaatacc
cggtacagccgagaaaaattcatgggtctcacagttgctttggatgatgaaggaaatgct
aaaggttgtctcttctgggatgatggagaaagcatcaatacatatgaaaatggagactat
tactttgcaaacttttctgctagaccgaacaatttggagcaccacatcattcacaacaaa
tacatagtagctacaaaaccgttgtggctcggctttattcatatatggggattaagcatt
gattctattaccaacgtcactgttgctcaaaaggaacatgttttaaccatagacaatttt
caacatgaccaagcaagacagatacttgcagtgaacttgactgcacaccagataacattg
gggcatccctttgtggtgacatggtga

DBGET integrated database retrieval system