KEGG   Monodelphis domestica (opossum): 100010022Help
Entry
100010022         CDS       T01031                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100010022 (GANC)
   00500 Starch and sucrose metabolism
    100010022 (GANC)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100010022 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 100010022
NCBI-ProteinID: XP_001362744
Ensembl: ENSMODG00000017915
UniProt: F7F2Q7
LinkDB All DBs
Position
1
AA seq 912 aa AA seqDB search
MEAAGSEDAISFQDEAVDKSIFKDCNKIGFYRRQKLLPRKNTYRALLDSVTSGKDSTKFQ
IINEVNKVPLLAEVYGIEGNIFRLKINEMAPLNPRYEISDVLIQKPATKRLTPCPGDTGT
LVLKDDSGNLKFHISANPFKIDLSSEEEPVLSINSTGRLYFEHLQMPPKHRISKEEDVMT
DPSQESQDDLGLWQEKFGKFVDIKANGPSAIGLDFSLHGFEHLYGIPQHAETHQLKNTSA
GEAYRLYNLDVYGYKIHDKMGIYGCVPYLLAHKQGRTVGIFWLNASETLVEINTQPTVEH
MLSQEGSVLAKQKVKAQTDVCWMSESGIIDVFLLMGPTPAAVFKQYSVLTGTQALPPLFS
LGYHQCRWNYDDEQDVKAVDAGFDAHDIPYDVIWLDIEHTEGKRYFTWDKKKFPDPKRMQ
ELIRSKKRKVVVITDPHIKVDPMYSLYSQAKDKGYFVKNNKGGDFEGVCWPGASSYLDFT
NPKVREWYSGLFAFSEYQGSTDILFIWNDMNEPSVFRGPELTMEKNAIHYGNWEHRDLHN
MYGFYQQMAAAEGLIQRSNGEERPFVLTRSFFAGSQKYGAVWTGDNKAEWGYLKISIPML
LTLSVAGIAFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHATMDTKRREPWLFGEEN
TQLIRNAIKERYALLPYWYSLFYHAHVASKPVMRPLWVEFPKELETFDVEDEYMLGSALL
IHPVTEPKATMVDVLLPGSEEVWYDFRTFVHWEGARTLKFPVALDSTPVFQRGGSVIPMK
TAVGRSTGWMPRLPYELRVALDSQGSARGELYLDDGHSFQYLHQKQFLHRKFLFSAGVLS
SSGADENGHYHSECVVEKVVILGINKQPSSVTASCPDMADTQVAFTYGSKTSVLRLEKLS
LNVGVDWEIHIK
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggctggcagcgaagacgccatcagctttcaagatgaagctgtggataaaagc
atatttaaggactgcaacaaaattggtttctacagacgtcagaagctactcccaaggaag
aatacctatcgggcattactggattcagtcacctcaggcaaagacagcaccaaattccag
atcatcaatgaagtgaataaggttcctctcttggctgaagtctatggaatagagggaaat
attttcaggttaaaaatcaatgaaatggctcccctgaatccaaggtatgaaatctccgat
gtcctcatacagaagccggctaccaaaaggctgacgccatgcccaggggatacaggtact
ctggtgctgaaagatgactcaggaaatctgaagtttcacatctcagcaaaccccttcaag
atagatctgtcttctgaagaagagcccgtgttaagcatcaattccacaggcaggctgtac
tttgaacatttgcagatgccacccaaacacagaatttccaaagaagaagatgtgatgact
gatccttcccaggaaagtcaagatgatctgggcctttggcaagagaaatttggcaaattt
gtggatatcaaagccaatggccccagcgccataggcctggacttctccttgcatggattt
gagcacctctatgggatcccacaacatgcagaaacccatcagctcaaaaacaccagtgct
ggagaagcttaccgcctatacaacctggacgtctatgggtacaagatacatgacaaaatg
ggtatctatggctgcgtgccttatctcctggcacacaaacaaggcagaacagtgggcatt
ttctggctgaatgcctcagaaaccttggtggaaatcaacacacagcctacagtggaacac
atgctgtcccaggaaggctcagttttggcgaagcagaaagtcaaggctcaaactgatgtg
tgttggatgtcagagagtggaatcattgatgtttttctgttaatgggaccaacccctgct
gcagtcttcaaacaatactcagtacttacaggcacacaagccctgcctccactcttctcc
ttgggataccatcagtgccgttggaactacgacgacgaacaagacgtcaaggctgtggat
gctgggtttgacgcccatgacatcccttatgacgtcatatggctggacatagaacacacc
gagggcaaacggtacttcacgtgggacaaaaagaaatttccagatcctaaaaggatgcaa
gagctgatcaggagtaaaaaacgcaaggtcgtggtcattactgacccccacatcaaggtt
gatcccatgtactcattgtactctcaggcaaaagacaagggttacttcgtgaaaaataac
aaaggtggagattttgagggtgtatgttggcctggagcctcttcttacctagatttcacc
aaccccaaggtacgagaatggtattcaggtctttttgccttctctgaatatcagggttct
actgacatcctctttatatggaacgatatgaatgagccttctgtctttagggggccagag
ctgaccatggagaagaatgccattcattatggcaactgggaacacagagaccttcataat
atgtatggcttttaccagcaaatggctgcagcagaaggcctgatccagaggtctaacggg
gaggagagaccctttgttttgacccgttctttctttgctggatcacagaagtatggtgca
gtatggacaggagacaacaaggcagagtggggttatctgaaaatttccatcccaatgttg
ctgactctcagtgtcgctggtattgctttttgtggagctgacgtaggaggatttatcgga
gacccggagccagagctgctggtacgctggtaccaggctggagcctaccagcccttcttc
cgaggccacgccaccatggacaccaagcggcgcgaaccctggctatttggagaggaaaat
acccagctcatcagaaacgccatcaaagagcgctatgccctcctgccttattggtattcc
ttgttctaccacgcgcatgtggcgtccaagcccgtcatgaggcccctttgggtagaattc
ccaaaggaattagaaacttttgatgtggaagatgagtacatgttggggagtgctttgcta
atacatccggtcacagaaccaaaggccacaatggtggatgtgcttttgcctgggtctgag
gaggtctggtatgacttccggacgtttgttcattgggaaggagcacgtaccctgaagttc
cccgtagccttggatagcacgccagtgtttcagcggggtggcagtgtgatacccatgaag
actgctgtcgggcggtccacagggtggatgccccgtctcccgtatgagctccgggtagct
ctggactcccagggttctgcaagaggcgaactctaccttgatgatggacattcattccaa
tacctccatcaaaagcagtttctccataggaagtttttattcagtgcaggtgttttgtct
tccagtggtgcagacgaaaatggtcattaccacagcgagtgtgtggtggaaaaagtcgtg
atcctgggcatcaataagcaaccttcctctgtgactgccagttgtcctgacatggcagac
acacaagtggcttttacctacggctccaagacctctgtgcttcgcctggaaaaactttca
ttgaatgttggcgttgattgggaaatccacatcaagtga

DBGET integrated database retrieval system