KEGG   Monodelphis domestica (opossum): 100010281Help
Entry
100010281         CDS       T01031                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100010281 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdo03036]
    100010281 (KMT5B)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100010281 (KMT5B)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100010281 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100010281
NCBI-ProteinID: XP_001362478
UniProt: H9H7X1
LinkDB All DBs
Position
Un
AA seq 902 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSNEHQPNQSKFQHAGKDALKAGRNAVERRSSRCSGTSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPWRSSRHFTKPDSCP
HTHSVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKTQERLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEYCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKTDATSNRKSSVGVKKSSKNRSLARPSSSSVSR
IPASSDTTSSKLTPIHNPRVPKKLKRPAIKPLLSKIKLRNQCKRPEQKGTSRKLQVGNLV
LKEPKVVLYKNLPIKKDKTAEGPASATAASGCLTRHAAREHRQGPVNGATEQDGGSAYIT
RRSVRTRTNWKETSEPALEPNLSGNSPSTWMGTGPGTDTDTVEPPVGHAVRDQEKAHEAT
SPKGEGRAPKDDISVAKKKSRQGKLLKQFAKAEEPISVLDAPEGDEVVPDLISSHSDHGE
SRDRVDGPASRQDCVPAATGGCSVGTPEHFKTKDNFRTAKSKKKRRITRYDAQLILENSS
GIPKLTLRRRHDSSSKAHDQDSDGMNASKISIKLSKDHDKDNSLYVAKLNNGFNSGSGGG
SATKLKIQLKREEESRGPYAEELRGDNGLCCQETLSLLESRMDMDDYSQYEEESAEESSS
SEEDDNDEDDEDDEDEDYEDEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRL
NA
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaacaccagccgaatcaatccaaatttcagcacgcgggaaaggacgccctg
aaggctggcagaaatgcagttgagagaaggtcaagcagatgtagtggcacttcagggttc
gagggacagagtcgctatgtaccttcttctgggatgtctgccaaggagctgtgtgagaat
gatgacctagccaccagtttggtgcttgatccctacctgggatttcagacccacaaaatg
aacactagcgccttcccttggaggagctccaggcattttaccaaacctgacagctgccct
catacgcactccgtgagattccgacctattaaaggaaggcaggaagagctgaaggaggtg
atcgaacgctttaaaaaagacgagcacttggagaaggccttcaaatgcctgacgtcaggc
gaatgggcccggcactattttcttaacaagaataaaacgcaagagcggttgttcaaagaa
catgtatttatttatttgcgaatgtttgcaactgacagtggatttgaaatcctgccctgc
aacagatactcgtcggagcagaatggagccaagatcgtggccacgaaagagtggaagcgg
aatgacaaaatcgagttgctggtgggctgcattgctgaactctcggagatagaggagaac
atgctgcttcggcacggagagaacgacttcagcgtcatgtactccaccaggaagaactgc
gcccagctctggctcggcccggcggcctttataaaccatgattgcagacctaactgtaag
tttgtttcaactggccgggacacggcctgcgtgaaagccctgagggacatcgagcccgga
gaagagatctcttgttactatggagacgggttttttggagaaaacaacgagtactgcgag
tgttacacttgtgaaaggcggggcactggtgcttttaagtcgagagtgggcctgcccgcg
cccgctcctgtcatcaacagcaaatatgggctgagagagaccgacaagcgcttaaacagg
ctcaaaaagctgggcgacagcagcaagaactccgatagccagtctgtcagctccaacacg
gatgcagacaccactcaggaaaaaaccgacgcaacttccaacaggaaatcatctgttggc
gtaaagaagagtagcaagaaccgatcgttagcacggccgtcgtcgtcgtcggtgtcccgg
ataccagcgtcctctgacactacctcatccaaactcactcctatccacaatcccagggta
ccaaagaaactgaaaaggcctgccatcaagcctttactttccaagataaagctaagaaac
cagtgcaaaaggccggagcagaagggcacctcgaggaagctccaggtgggcaacctggtc
ctcaaagagcccaaagtggttctctacaaaaacctgcccatcaaaaaggacaagacagcc
gagggaccagcgagtgccacagcggccagcgggtgcctgacccgccatgccgcccgagaa
caccggcaggggcctgtgaacggggccaccgagcaggacggggggtctgcctacatcact
cggaggtcagtgaggacgagaaccaattggaaggagacctctgagccggccctcgaacca
aacctgtcaggcaactctccgagcacctggatgggcacgggccctggcacagacacggac
accgtggagccgcccgttggccatgcagtgcgtgaccaggaaaaggctcatgaagccaca
tccccaaaaggggaggggagggccccaaaggatgacataagcgtggccaaaaagaaatcg
cgacaaggaaaacttttgaaacagtttgcaaaagcagaggagcccatctcggtcctggat
gctcctgagggtgatgaagtggtgcccgacctcatcagctctcactctgaccatggagag
tccagggacagagtggacgggccagctagccgccaggactgcgtccctgccgccacgggg
ggttgttctgtggggacccctgagcatttcaaaacaaaagacaactttagaactgcaaaa
agcaaaaaaaaacgtcgcatcacgaggtacgatgcccagctaatcctagagaacagctct
gggatccccaaattgactctgcggagacgccacgatagcagcagtaaggcccacgaccaa
gacagcgacggcatgaacgcttccaaaatcagcatcaagctaagcaaagaccacgacaaa
gacaacagcctgtacgtggccaagctcaacaatgggtttaactcagggtcaggcggcggc
agcgccaccaaattaaagattcagctcaaacgtgaggaggagagccggggcccctacgca
gaggagctccgtggcgacaacgggctctgctgccaggagaccctgtccctcctggagtcg
aggatggacatggacgactacagccagtacgaggaggagagcgccgaggagtcgtcctct
tcagaggaagatgacaacgacgaggacgacgaggacgacgaggacgaggactacgaagat
gagttcgaggacgacttcatccctcttcctccggccaagcggctcaggctcatcgtaggc
aaagactcgattgacatcgacatttcctcgaggaggagagaagaccagtctctgaggctc
aacgcctaa

DBGET integrated database retrieval system