KEGG   Monodelphis domestica (opossum): 100010613Help
Entry
100010613         CDS       T01031                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00512  Mucin type O-glycan biosynthesis
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100010613 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdo01003]
    100010613 (WBSCR17)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100010613 (WBSCR17)
Glycosyltransferases [BR:mdo01003]
 O-Glycan biosynthesis
  Mucin-type
   100010613 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100010613
NCBI-ProteinID: XP_001363039
Ensembl: ENSMODG00000006826
UniProt: F6PG76
LinkDB All DBs
Position
2
AA seq 596 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVKSADAFRDVHTRAEAANLTQHGPSTVQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKRLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLTRYTREGFLHLGALGTTTLLPDTRCLVDNSKSRFPQLLD
CDKVKSSLHKRWNFIQNGAIMNKGTGRCLEVESRPSIDLILRSCTGQRWTIKNFIK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagggtcaaagtgctgctggtattgaatttgatcgccgtggccggc
ttcgtgctcttcttggctaagtgtcggcccatttcggtgaagagtgcggacgccttccgg
gacgtccatacccgggcagaggcggcgaacttgacccagcacggccctagcaccgtccag
gatgcggtgctgaagaggctctccctactggaggacatcgtctacaggcagctcaatggt
ttatccaaatccctcggactcatcgaaggctatggggggcgggggaaaggagggctacct
gccaccctttccccatctgaagaagaaaaagccaagggcccgcacgagaagtatggctac
aattcctaccttagtgaaaaaatttcactggatcgttccataccggattatcgcccaacc
aagtgtaaggagctgaaatactccaaggatctgccccagatctccatcatatttatcttc
gtgaacgaggccctgtcggtgatcctacggtctgtccacagtgccgtcaatcacacaccg
gcgcatctcctgaaggagattatcctggtggatgacaacagtgatgaagaggagctgaag
gcacccttggaggaatatgttcataaacgttatccagggctggtgaaggtggtacgaaat
cagaagagggaaggtctgattcgggcacggatcgaaggctggaaagtggccactggtcag
atcactggtttcttcgatgctcacgtggagttcaccgctggctgggctgagcctgttctg
tccagaatccaggaaaatcgaaaaagggtgatccttccctctattgacaacatcaaacag
gataacttcgaggtacagcggtatgagaactcggcccatggttacagctgggagctttgg
tgcatgtacatcagtcccccaaaggactggtgggacgcaggggacccttcccttcccatc
aggaccccagcaatgattgggtgttcgtttgtggtcaacaggaagttctttggggaaata
ggcctcctggaccctgggatggatgtgtacggaggagagaacattgaacttgggatcaag
gtatggctctgtggaggcagtatggaggtcctgccctgctccagagtagctcacatcgag
cggaagaagaagccctacaacaataacattggcttctacaccaagaggaatgccttgaga
gtggccgaggtctggatggatgattacaagtcccatgtgtacatagcctggaacttgccc
ttggagaatccaggcatagacattggtgatgtctcagaaaggagagctttaaggaaaagg
ttgaagtgcaagaatttccagtggtacctggaccatgtttatcctgaaatgaggaggtac
aacaacaccatcgcctacggggagcttcgcaacaacaaggctaaagacgtctgtttggac
caggggcctcaagagaatcacactgcaatactctatccttgccacggctggggacctcag
ctcacccgctacaccagggaaggcttcctgcatctgggggctctggggaccaccaccctc
ttgccggacacccgctgccttgtggacaactcgaaaagccgctttccccaacttctcgac
tgtgacaaggtcaagagcagcctacacaaacgctggaatttcatacagaatggagctatc
atgaataaggggacaggccgctgcctggaagttgagagccggcccagcatcgaccttatc
ctccgtagctgcacggggcaaagatggacaattaaaaacttcataaagtag

DBGET integrated database retrieval system