KEGG   Monodelphis domestica (opossum): 100010618Help
Entry
100010618         CDS       T01031                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04910  Insulin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04931  Insulin resistance
Module
mdo_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100010618 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100010618 (GYS2)
   04152 AMPK signaling pathway
    100010618 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100010618 (GYS2)
   04922 Glucagon signaling pathway
    100010618 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100010618 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdo01003]
    100010618 (GYS2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100010618 (GYS2)
Glycosyltransferases [BR:mdo01003]
 Polysaccharide
  Storage polysaccharide
   100010618 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100010618
NCBI-ProteinID: XP_001363412
Ensembl: ENSMODG00000017796
LinkDB All DBs
Position
8
AA seq 699 aa AA seqDB search
MMRGRSLSVTSLSGLPLWDVQELPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYCLIGPYFEHNMKTQVEECEPPSPAIKKAVEAMNLHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACNIGIPYHDQEANDMLIFGSLTAWFLKEVTDHVDGKHVIAQFH
EWQAGTGLILSRSRRLPVATIFTTHATLLGRYLCAANIDFYNHLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNIKKFSAVHEFQNLHALY
KSKIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRVHKNDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTANSVKEKFGKKLYDALLKGEIPDLNKIL
DRDDVTIMKRAIFSTQRQCLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVTDPAAYGIYIVDRRFCSPDESCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMHARHLTLSRAFPDKFHVESSPTTQGFKFPRPSSVPPSPTSSQHSSPQASDVEDE
DERYDEEEEAERDRLNIKSPFILGQVPHEKKKQHGEHKN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaggaagatcgctgtctgtgacctccctgagtgggcttcccctgtgggatgtg
caagaacttccagtagaggatttgctgctcttcgaagttgcctgggaagtgaccaataaa
gttggtggcatctatactgtaatccagaccaaagcaaaaacaactgcagatgaatgggga
gaaaattattgtctgattggtccatattttgaacacaatatgaagacacaagtggaagaa
tgtgagcctccaagccctgcaattaaaaaggcagtggaagcaatgaatttacatgggtgt
caggttcactttggacgatggctcatagaaggaagcccttatgtggtgctgttcgacata
ggatattctgcgtggaatttggacagatggaaaggagacctctgggaagcatgcaacata
ggaatcccttaccatgaccaagaggctaacgatatgcttatatttgggtcattaactgcc
tggttcttaaaagaggtgactgaccatgtggatggtaaacatgtcattgctcaatttcat
gaatggcaggcaggaactggactaattctttctcgatccaggagacttcctgttgccact
atatttacgacccatgcaacattgcttggaaggtacctctgtgcagcaaacattgatttc
tacaaccaccttgataagtttgatatagacaaggaagctggggagagacaaatttaccat
cggtactgcatggagcgagcttccgttcattgcgctcacgtattcactactgtttctgaa
atcactgccattgaagctgaacacatgctgaaaagaaaacctgatgtggttactccaaat
ggcctgaatattaagaaattttcagctgtgcatgagtttcaaaatttgcatgctttatac
aagtccaagatccaggattttgttcgtggtcatttctatggtcatcttgatttcgacctt
gaaaaaactttattccttttcattgcggggagatacgaattttcaaacaaaggagctgac
atcttcttagaagctttatctaggctaaacttcctcttacgggtccataaaaatgatgtc
acagttgtagtgtttttcattatgcctgccaagacaaataattttaatgtggaaaccttg
aaaggacaagcagtgagaaagcaactatgggacactgcaaattcagtgaaggaaaagttt
ggaaagaaactctatgatgcactactaaaaggagaaattcctgatttgaacaagattctg
gatcgggatgatgtgacaattatgaaaagagccatcttttccactcagcgacaatgcttg
cctccagtgactactcacaatatgattgatgattccactgatcccatcctcagcaccatc
aggcggattggacttttcaatagccggacagacagagtcaaggtgattttacatccagaa
ttcctttcttcaaccagtccattattacctatggattatgaagagttcgtcagaggctgt
catcttggagtctttccatcatactatgaaccctggggttatactccagccgaatgcacc
gtgatgggtattcctagtgtgacaacaaacctctctggctttggttgtttcatgcaggag
catgtaactgacccagctgcttatggaatttatattgttgacaggaggttctgctcacca
gacgagtcctgcaatcagcttactcaatttctctatggattctgcaaacagtctcggcgt
cagaggattattcaaaggaacagaactgaaagactctctgatttgttagactggaaatac
ttaggcaggtactacatgcatgccagacacctgaccctgagcagagcttttccagataaa
tttcatgttgaatcttcaccaacgacacaaggttttaaatttccaaggccttcatcagtg
ccaccatcacctacaagctctcagcattccagtcctcaagccagtgatgtggaagatgag
gatgaaagatatgatgaagaagaggaggctgaaagggatcgcttgaatattaaatctcca
tttattttgggtcaagttcctcatgaaaagaaaaaacaacatggcgaacacaagaattga

DBGET integrated database retrieval system