KEGG   Monodelphis domestica (opossum): 100010738Help
Entry
100010738         CDS       T01031                                 

Gene name
EZH1
Definition
(RefSeq) enhancer of zeste 1 polycomb repressive complex 2 subunit
  KO
K17451  histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100010738 (EZH1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100010738 (EZH1)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100010738 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     100010738 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 100010738
NCBI-ProteinID: XP_001362953
Ensembl: ENSMODG00000015033
LinkDB All DBs
Position
2
AA seq 768 aa AA seqDB search
MSKKTEDQRGKVACPKLNSKMDIPNSPTSKCITYWKRKVKSEYMRLRQLKRFQANMGAKA
LFVANFAKVQEKTQILNEDWKRLRIQPVQLMKPVSGHPFLKKCTVESNFPGFDSQDMLMR
SLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHG
EEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNNDSSEGKQEDNKEELPVLRKRKRLT
IEGNKKSSKKQFPNDMIFSAISSMFPENGVPDDMKERYRELTEVSDPNVLPPQCTPNIDG
PCAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPDPCGLDCFL
WLEGAKEYAMLHNPRSKCSGRRRRRHQVVNASSTNTSTSAVAETKEGDSDRDTGNDWASS
SSEANSRCQTPTKQKASPAPPQLCVVEAPLEPVEWTGAEESLFRVFHGTYFNNFCSIARL
LGTKTCKQVFQFAVKESLILKLPTNELMNPSQKKKRKHRLWAAHCRKIQLKKDNSATQVY
NYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVR
ECDPDLCLTCGASEHWDCKVVSCKNCSIQLGLKKHLLLAPSDVAGWGTFIKESVQKNEFI
SEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAK
VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaactgaggaccaaagagggaaagtggcttgcccaaagttgaacagcaaa
atggatatcccaaattctcccacctccaaatgtatcacttactggaagagaaaagttaag
tctgagtatatgcgacttcgacagctcaaacggtttcaggcaaatatgggtgcaaaggcc
ctgtttgtggccaattttgcaaaagttcaagaaaaaactcagatcctcaatgaagactgg
aagaggctccgaatccagcctgttcaattgatgaagcctgtgagtgggcatcctttcctc
aaaaagtgtactgtagaaagcaattttccaggatttgacagccaggatatgttaatgaga
tctctgaatacagttgcattggtacccatcatgtattcctggtctcctctccagcaaaat
ttcatggtggaagatgagactgttttgtgcaatattccctacatgggagatgaggttaaa
gaagaagatgaaactttcattgaagaactgatcaataactatgatgggaaagtccatggg
gaagaagagatgatcccaggttctgtcctgatcagtgatgctgtgttcttggagttggtt
gatgccctgaatcagtactcggatgaggaagaggaggggcacaataatgactcttctgaa
gggaaacaggaagacaacaaggaagagttgccagttcttaggaaaagaaaacgactcacc
attgaaggcaacaaaaagagttccaagaaacaatttccaaatgacatgatcttcagtgcc
atttcttccatgttccctgagaatggtgttccagatgacatgaaagagaggtatcgcgaa
ctcacagaggtgtcggaccccaatgttttgcctccccagtgcaccccaaacatcgatggc
ccttgtgccaagtctgtgcagcgagaacagtcactgcattccttccacacactcttctgc
cgacgttgcttcaaatatgactgcttccttcacccttttcatgccacacctaatgtatac
aaacggaagaacaaagaaatcaagattgaaccagacccatgtggattggactgctttctg
tggctggaaggagcaaaggaatatgccatgcttcacaatccacgctcaaaatgctctggg
cgtcgaagacgtcgacaccaagtggtcaatgcttcttccaccaacacttccacctctgct
gtggctgagacaaaagagggagacagtgacagggacacaggaaatgactgggcttccagc
tcttcagaggccaactctcggtgtcagacacctaccaaacaaaaggccagccctgccccg
cctcagctctgtgtagtggaagcacccctagaacctgtggaatggactggagctgaggag
tccctcttcagagtgttccatgggacctatttcaacaacttctgttcaatagccaggctc
ctggggactaaaacgtgcaagcaggtcttccagtttgcagtcaaagagtcacttatcttg
aagttgccaacaaatgagctcatgaacccctcacagaagaagaaaagaaaacacaggctg
tgggctgcacactgcagaaagattcagctcaagaaagataactccgccacacaggtgtac
aactaccaaccctgtgaccatccagaccgtccctgcgacagcacctgcccctgcatcatg
acccagaatttctgtgagaagttctgccagtgcaacccagactgtcaaaaccgattccca
ggctgccgctgcaagacccagtgtaacaccaaacagtgtccctgctacctcgctgttcgg
gaatgtgaccccgacctgtgtctcacctgtggggcctcagagcactgggactgcaaggtg
gtctcctgcaagaattgcagtatccagcttggtcttaagaagcacctgctgctggccccc
tcagatgtggctggatggggcaccttcatcaaagagtctgtacagaagaatgaattcatt
tctgaatattgtggcgagcttatctctcaggatgaggctgaccggcggggaaaggtctat
gacaagtacatgtccagctttctcttcaacctcaacaatgattttgtggtggacgccacc
cggaaaggaaataaaattcgatttgcaaaccactcagtgaatcccaattgctatgccaaa
gtggtgatggtgaatggagatcatcggattggaatctttgccaaaagagccatccaggct
ggggaagaactcttttttgattacaggtacagccaagccgatgccctcaaatatgtgggg
attgagagggagacagatgtcctctag

DBGET integrated database retrieval system