KEGG   Monodelphis domestica (opossum): 100012866Help
Entry
100012866         CDS       T01031                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00480  Glutathione metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo00983  Drug metabolism - other enzymes
mdo01524  Platinum drug resistance
mdo05200  Pathways in cancer
mdo05204  Chemical carcinogenesis
mdo05225  Hepatocellular carcinoma
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100012866 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100012866 (MGST3)
   00982 Drug metabolism - cytochrome P450
    100012866 (MGST3)
   00983 Drug metabolism - other enzymes
    100012866 (MGST3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100012866 (MGST3)
   05204 Chemical carcinogenesis
    100012866 (MGST3)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    100012866 (MGST3)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100012866 (MGST3)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    100012866 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdo02000]
    100012866 (MGST3)
Enzymes [BR:mdo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100012866 (MGST3)
Transporters [BR:mdo02000]
 Other Transporters
  Pores ion channels [TC:1]
   100012866 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100012866
NCBI-ProteinID: XP_001363682
Ensembl: ENSMODG00000001305
UniProt: F7BZK3
LinkDB All DBs
Position
2
AA seq 152 aa AA seqDB search
MAVLSKEYGFVVLTGAASFILVTHLAINVGKARKKYKVEYPTMYSTDPENGHVFNCIQRA
HQNTLEVYPSYLFFLAVGGIYHPRLVSGLGLAWIIGRVLYAYGYYSGDPSKRNRGLVGSF
ALLGLMGTTVYSAFQHLGWVNQGLGHGPRSCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcctctcaaaggaatatggttttgttgttctcactggggctgccagtttcata
ttggtcactcaccttgccatcaatgttggcaaagcccgtaagaagtacaaggtagagtat
cccaccatgtacagtactgatcctgaaaacgggcatgtttttaactgcattcagcgagcc
caccagaatacattggaagtgtacccttcctacttgttctttctagcagttggaggcatt
taccatcctcgcttagtttctggtttgggacttgcctggataattggacgtgtactttat
gcttatggctactattcaggagacccaagcaagcggaatcgaggcctggtgggttccttt
gctctcctaggactgatgggcacaactgtgtactctgctttccaacatcttggttgggtt
aaccaaggtctgggccacggacctaggagttgtcattga

DBGET integrated database retrieval system