KEGG   Monodelphis domestica (opossum): 100012866Help
Entry
100012866         CDS       T01031                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00480  Glutathione metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo00983  Drug metabolism - other enzymes
mdo01524  Platinum drug resistance
mdo05200  Pathways in cancer
mdo05204  Chemical carcinogenesis
mdo05225  Hepatocellular carcinoma
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100012866 (MGST3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100012866 (MGST3)
   00982 Drug metabolism - cytochrome P450
    100012866 (MGST3)
   00983 Drug metabolism - other enzymes
    100012866 (MGST3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100012866 (MGST3)
   05204 Chemical carcinogenesis
    100012866 (MGST3)
   05225 Hepatocellular carcinoma
    100012866 (MGST3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100012866 (MGST3)
  Drug resistance
   01524 Platinum drug resistance
    100012866 (MGST3)
Enzymes [BR:mdo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100012866 (MGST3)
Transporters [BR:mdo02000]
 Other Transporters
  Pores ion channels [TC:1]
   100012866 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100012866
NCBI-ProteinID: XP_001363682
Ensembl: ENSMODG00000001305
UniProt: F7BZK3
LinkDB All DBs
Position
2
AA seq 152 aa AA seqDB search
MAVLSKEYGFVVLTGAASFILVTHLAINVGKARKKYKVEYPTMYSTDPENGHVFNCIQRA
HQNTLEVYPSYLFFLAVGGIYHPRLVSGLGLAWIIGRVLYAYGYYSGDPSKRNRGLVGSF
ALLGLMGTTVYSAFQHLGWVNQGLGHGPRSCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcctctcaaaggaatatggttttgttgttctcactggggctgccagtttcata
ttggtcactcaccttgccatcaatgttggcaaagcccgtaagaagtacaaggtagagtat
cccaccatgtacagtactgatcctgaaaacgggcatgtttttaactgcattcagcgagcc
caccagaatacattggaagtgtacccttcctacttgttctttctagcagttggaggcatt
taccatcctcgcttagtttctggtttgggacttgcctggataattggacgtgtactttat
gcttatggctactattcaggagacccaagcaagcggaatcgaggcctggtgggttccttt
gctctcctaggactgatgggcacaactgtgtactctgctttccaacatcttggttgggtt
aaccaaggtctgggccacggacctaggagttgtcattga

DBGET integrated database retrieval system