KEGG   Monodelphis domestica (opossum): 100013036Help
Entry
100013036         CDS       T01031                                 

Gene name
PTEN
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00562  Inositol phosphate metabolism
mdo01100  Metabolic pathways
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo04068  FoxO signaling pathway
mdo04070  Phosphatidylinositol signaling system
mdo04071  Sphingolipid signaling pathway
mdo04115  p53 signaling pathway
mdo04140  Autophagy - animal
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04218  Cellular senescence
mdo04510  Focal adhesion
mdo04931  Insulin resistance
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05200  Pathways in cancer
mdo05206  MicroRNAs in cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05218  Melanoma
mdo05222  Small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05230  Central carbon metabolism in cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100013036 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100013036 (PTEN)
   04070 Phosphatidylinositol signaling system
    100013036 (PTEN)
   04071 Sphingolipid signaling pathway
    100013036 (PTEN)
   04151 PI3K-Akt signaling pathway
    100013036 (PTEN)
   04150 mTOR signaling pathway
    100013036 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100013036 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100013036 (PTEN)
   04218 Cellular senescence
    100013036 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100013036 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100013036 (PTEN)
   05206 MicroRNAs in cancer
    100013036 (PTEN)
   05230 Central carbon metabolism in cancer
    100013036 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100013036 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100013036 (PTEN)
   05214 Glioma
    100013036 (PTEN)
   05218 Melanoma
    100013036 (PTEN)
   05215 Prostate cancer
    100013036 (PTEN)
   05213 Endometrial cancer
    100013036 (PTEN)
   05224 Breast cancer
    100013036 (PTEN)
   05222 Small cell lung cancer
    100013036 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100013036 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100013036 (PTEN)
   05165 Human papillomavirus infection
    100013036 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100013036 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdo01009]
    100013036 (PTEN)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100013036 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     100013036 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100013036 (PTEN)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100013036 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DUF3256
Motif
Other DBs
NCBI-GeneID: 100013036
NCBI-ProteinID: XP_001363283
Ensembl: ENSMODG00000016499
UniProt: F7EQJ0
LinkDB All DBs
Position
1
AA seq 404 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKHHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYTSPSGPTRREDKYMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEENSDKVENGSLCGDQE
IDSICSAERSDNDKEYLILTLSKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPSNPEA
SSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaggagatcgtgagcagaaacaaaaggagataccaggaggatgga
ttcgacttggacttgacctatatttatccaaacatcattgctatggggtttcctgcagaa
agacttgaaggcgtgtacaggaacaacattgatgatgtcgtcaggtttttggattcaaag
cataaaaatcattacaagatatacaatctatgtgctgaaagacattatgatgccaccaaa
tttaactgtagagttgcacagtatccttttgaagaccataacccgccccagctagagctc
atcaagcctttctgtgaggacctggaccagtggctaagtgaagatgacaatcatgttgca
gcaattcattgtaaagcaggaaagggacggactggggtcatgatctgtgcgtatttatta
catcgaggaaaatttttaaaggcccaagaggctctagatttctatggggaagtcaggacc
agagacaaaaagggagtgaccattcccagtcagaggcgctatgtgtattattatagccac
ctgttaaagcatcacttggactacagaccggtggccctgctgtttcacaagatgatgttt
gaaacaattccgatgttcagtggtggaacttgcaatcctcagtttgtggtctgccagctg
aaggtgaagatttatacgtctccttcaggacccacaaggcgggaagacaagtacatgtac
ttcgagtttccccagcctttgccggtgtgtggtgacatcaaagtggaattcttccacaag
caaaacaagatgctcaagaaggacaaaatgtttcacttttgggtaaatacattcttcata
ccaggaccagaggaaaactcagacaaagtagaaaatggaagtctttgtggtgatcaagag
attgatagtatttgcagtgccgagcgatcggataacgacaaggaatatctcatactcacg
ttgtccaaaaatgatctcgacaaagcaaataaagacaaggccaacagatacttttctcca
aactttaaggtgaagcttttcttcacaaagacggtcgaggagccgtcgaaccccgaggcc
agcagctccacgtcggtcacgccggacgttagtgacaatgagcccgaccattaccggtac
tcggacaccactgactctgacccagagaatgagcctttcgacgaagatcagcacacacag
atcacaaaagtctga

DBGET integrated database retrieval system