KEGG   Monodelphis domestica (opossum): 100013088
Entry
100013088         CDS       T01031                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04020  Calcium signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04144  Endocytosis
mdo04151  PI3K-Akt signaling pathway
mdo04510  Focal adhesion
mdo04540  Gap junction
mdo04630  JAK-STAT signaling pathway
mdo04810  Regulation of actin cytoskeleton
mdo05163  Human cytomegalovirus infection
mdo05200  Pathways in cancer
mdo05206  MicroRNAs in cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05218  Melanoma
mdo05230  Central carbon metabolism in cancer
mdo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100013088 (PDGFRA)
   04014 Ras signaling pathway
    100013088 (PDGFRA)
   04015 Rap1 signaling pathway
    100013088 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100013088 (PDGFRA)
   04020 Calcium signaling pathway
    100013088 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100013088 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100013088 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100013088 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100013088 (PDGFRA)
   04540 Gap junction
    100013088 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100013088 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100013088 (PDGFRA)
   05206 MicroRNAs in cancer
    100013088 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100013088 (PDGFRA)
   05231 Choline metabolism in cancer
    100013088 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100013088 (PDGFRA)
   05218 Melanoma
    100013088 (PDGFRA)
   05215 Prostate cancer
    100013088 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100013088 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100013088 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100013088 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mdo04090]
    100013088 (PDGFRA)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100013088 (PDGFRA)
Protein kinases [BR:mdo01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100013088 (PDGFRA)
CD molecules [BR:mdo04090]
 Proteins
  100013088 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Adeno_E3_CR1
Other DBs
NCBI-GeneID: 100013088
NCBI-ProteinID: XP_001363229
Ensembl: ENSMODG00000020670
UniProt: F7E5I9
LinkDB
Position
5
AA seq 1085 aa
MGTSPWALLVLGCLLTGPWLAFCQLPLPTVFPNEDEKVVQLHSSFTLRCSGDSEVSWQYP
MQDEEDHKIEVRNEENNSGLFVTVLEVVNASAVHTGLYTCYYNHTQTEETEIEGRDIYIY
VPDPDVAFVPSVMVDHLIFAEEHDSVTIPCRTTDPLAQVTLLNSDNKVVHAFYDSRQGFI
GNFAMGQFKCETTIKGKTFQTVPFNIYTITATPELEVEIEAEKTVYKTGETLVVTCAVLH
NEVVDLQWNYPGKVKNKGILKVDEIKVPSLKLVYTLTVPKVTVKDSGDYECAARHATKET
KKIKKVTISVHEKGFIELNPNFRQSEAINLHEVRHFVVDVQAYPPPKISWLKDNMTVIEN
LTEIITGLDKIQEIRYQSKLKLIRAKEEDSGNYTIMAQNEDDIKNYTFQLIIQVPASILD
LEDDNHGSAGGQTVKCMAEGTPLPVVEWMVCKDITKCNNETSWTHLASNTSDITEKQDSS
MVESQVTFNKIEDTMAVRCLARNLLGSVTRELKLVAPAMRSELTVAASVLVLLVIVIFSL
IILIVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSG
AFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLG
ACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSHHPEKTKKELDIFGMNSADESTRSYVI
LSFENNGDYMDMKQADTTQYVPMLERKQGSKYSDIQRSMYDRPASYKKKSVSDPEVKNLL
SDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARD
IMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVD
STFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSY
EKIHLDFLKSDHPAVARMRVDCDNTYIGVTYKNEDQMKDWEGSYDEQRLSADSGYIIPLP
DIDPIPEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDPSDLI
EDSFL
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgggtacctccccatgggcattgctggtcctgggatgtcttcttacagggccgtggctc
gcattttgccagcttccattacccactgtctttccgaatgaggatgaaaaggttgtgcag
ctgcattcatcttttaccctaagatgctctggggacagtgaagtgagctggcagtacccc
atgcaggatgaagaggaccacaaaatagaagtcagaaatgaggagaacaacagtggcctt
tttgtgacggtcctggaagtggtcaatgcctcagctgtccacacagggctgtacacttgt
tattacaaccatactcagacagaggagacggagatcgaaggcagagatatctacatctat
gtgccagatccagatgtagcgtttgtaccttctgtcatggttgatcatttaatttttgcg
gaggaacatgattctgtcactattccatgtcgcacaacggatcctctggctcaggtgacc
cttctcaacagtgataacaaagtggtacatgcattctatgatagcagacaaggctttatt
ggaaactttgccatgggacaattcaagtgtgagacaaccatcaaggggaaaacattccaa
acagttccattcaacatttatacaataacagctactccagagcttgaagttgagatagag
gcagagaaaactgtttacaaaacaggagaaactcttgttgtaacttgtgctgtcttgcac
aatgaggtggttgatcttcagtggaattacccgggaaaagtgaaaaacaaaggcattttg
aaagttgatgaaatcaaagttccatccctcaagttggtgtacacgctgactgtcccaaag
gtgacggtgaaagacagtggtgactatgaatgtgctgcccgtcatgctactaaggaaaca
aagaagattaagaaagtcaccatttctgtccatgagaagggatttattgagctcaatccc
aacttccgccagtcagaagccattaacttgcacgaagtgcgccattttgtagtggatgta
caggcgtatccaccaccaaagatatcttggcttaaggacaatatgactgtgattgagaat
ctcactgagatcatcactggcttagataagatccaggaaataaggtatcaaagcaagtta
aaactgattcgtgctaaggaagaagacagtggcaattacactattatggcccaaaatgag
gatgatattaagaactatacttttcaacttataattcaagttccagcttctattctggac
ctagaagatgacaaccatggctctgcaggagggcagacggtcaaatgcatggcagaaggg
acaccgcttccagttgtggaatggatggtttgcaaggacattacaaagtgtaataatgaa
acttcgtggacacatttggccagcaatacatccgacattacagaaaaacaagacagcagt
atggtagagagccaagtgaccttcaacaaaattgaagacactatggctgtacgatgccta
gcaaggaacttacttgggtcggtgactcgggaactgaaacttgtggctcctgctatgcgc
tcagaattgacagtggctgcctcagtcctagtgctgctagtgattgtcatcttttccctc
attatcctgatcgtcatatggaagcagaaacccaggtatgaaatccggtggagggtcata
gagtccatcagccctgatggccatgagtacatttatgtggacccaatgcagttgccttat
gattcaagatgggagtttcctagagatgggttagtccttggccgaatcctgggctcaggt
gcatttggaaaagtggtggaaggaactgcttatggattaagccgttcccaacctgtgatg
aaggtggcggtgaaaatgctaaaacccacagctagatctagtgaaaaacaggctctcatg
tcagaactgaagattatgactcatctgggaccccatttgaatatcgtaaatcttttagga
gcctgtaccaagtcagggcccatttatatcatcactgaatactgcttctatggggattta
gtcaactacctgcataagaacagagacaacttcttgagccatcatccagagaagacaaag
aaagagctggacatctttgggatgaactccgctgatgaaagcactaggagctatgtcatt
ttatcctttgaaaacaatggggattatatggacatgaagcaagcggataccacacaatac
gttcccatgctggagagaaaacagggctctaaatattcagatatccaaagatcgatgtat
gatcggcctgcatcatacaagaagaaatctgtatcagacccagaagttaaaaacctcctt
tcagatgatagttcagaaggtctcagtctcttggatctgctaagcttcacctatcaagta
gcccgaggaatggagtttttggcctctaaaaactgtgtgcaccgtgatctggctgctcgt
aatgtccttctggctcaaggaaaaatcgtgaagatttgtgactttggcctggccagagac
atcatgcatgattccaactatgtgtccaagggcagtacttttctccctgtgaagtggatg
gctcctgaaagtatctttgacaatctgtataccacactgagtgacgtctggtcttatggc
atcctgctatgggagatcttttcccttggaggcacaccctatcctggaatgatggtggat
tctactttctataataaaatcaaaagtggataccggatggccaaacccgaccatgccacc
agtgaagtatatgaaatcatggtgaagtgctggaatagtgagcccgagaagagaccctcc
ttttaccacctgagtgagattgtggaaaatttgctacctggacaatataagaagagttat
gagaaaatccacctggacttcctgaagagtgaccaccctgccgttgctcgcatgagagtg
gattgtgataacacttacattggtgtcacctacaaaaatgaagaccagatgaaggactgg
gagggcagctatgatgaacagaggctgagtgctgacagtggctatatcatccctctgcct
gacattgaccctatccctgaagatgacctaggcaagagaaacagacacagttcccagaca
tctgaggaaagtgccattgagacaggttccagcagctccaccttcatcaagagagaggat
gaaaccatcgaggatatcgacatgatggatgacattgggatagacccgtcagacctgatt
gaagacagcttcctgtaa

DBGET integrated database retrieval system