KEGG   Monodelphis domestica (opossum): 100013257
Entry
100013257         CDS       T01031                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04068  FoxO signaling pathway
mdo04110  Cell cycle
mdo04115  p53 signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04218  Cellular senescence
mdo04310  Wnt signaling pathway
mdo04340  Hedgehog signaling pathway
mdo04371  Apelin signaling pathway
mdo04390  Hippo signaling pathway
mdo04510  Focal adhesion
mdo04530  Tight junction
mdo04630  JAK-STAT signaling pathway
mdo04917  Prolactin signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04934  Cushing syndrome
mdo05160  Hepatitis C
mdo05162  Measles
mdo05163  Human cytomegalovirus infection
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05210  Colorectal cancer
mdo05212  Pancreatic cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05222  Small cell lung cancer
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100013257 (CCND1)
   04340 Hedgehog signaling pathway
    100013257 (CCND1)
   04390 Hippo signaling pathway
    100013257 (CCND1)
   04371 Apelin signaling pathway
    100013257 (CCND1)
   04630 JAK-STAT signaling pathway
    100013257 (CCND1)
   04068 FoxO signaling pathway
    100013257 (CCND1)
   04151 PI3K-Akt signaling pathway
    100013257 (CCND1)
   04152 AMPK signaling pathway
    100013257 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100013257 (CCND1)
   04115 p53 signaling pathway
    100013257 (CCND1)
   04218 Cellular senescence
    100013257 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100013257 (CCND1)
   04530 Tight junction
    100013257 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100013257 (CCND1)
   04921 Oxytocin signaling pathway
    100013257 (CCND1)
   04919 Thyroid hormone signaling pathway
    100013257 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100013257 (CCND1)
   05206 MicroRNAs in cancer
    100013257 (CCND1)
   05205 Proteoglycans in cancer
    100013257 (CCND1)
   05203 Viral carcinogenesis
    100013257 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100013257 (CCND1)
   05212 Pancreatic cancer
    100013257 (CCND1)
   05225 Hepatocellular carcinoma
    100013257 (CCND1)
   05226 Gastric cancer
    100013257 (CCND1)
   05214 Glioma
    100013257 (CCND1)
   05216 Thyroid cancer
    100013257 (CCND1)
   05221 Acute myeloid leukemia
    100013257 (CCND1)
   05220 Chronic myeloid leukemia
    100013257 (CCND1)
   05218 Melanoma
    100013257 (CCND1)
   05219 Bladder cancer
    100013257 (CCND1)
   05215 Prostate cancer
    100013257 (CCND1)
   05213 Endometrial cancer
    100013257 (CCND1)
   05224 Breast cancer
    100013257 (CCND1)
   05222 Small cell lung cancer
    100013257 (CCND1)
   05223 Non-small cell lung cancer
    100013257 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100013257 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100013257 (CCND1)
   04934 Cushing syndrome
    100013257 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100013257 (CCND1)
   05162 Measles
    100013257 (CCND1)
   05160 Hepatitis C
    100013257 (CCND1)
   05163 Human cytomegalovirus infection
    100013257 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100013257 (CCND1)
   05169 Epstein-Barr virus infection
    100013257 (CCND1)
   05165 Human papillomavirus infection
    100013257 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100013257 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100013257
NCBI-ProteinID: XP_003341624
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRALQTMLKAEETCSPSVSYFKCVQKDILPYMRKIV
ATWMLEVCEEXKCEREVFLSALNYSDRVLSLEPVKKSRLXVPGATCMFGGSRMKETLPPD
GRKLASSPHHPGPPQELSHMELLLVNKLKWHLAAMTPHDFIEHFLSKMPVLEENKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGSTNSFLTYQRLTRFLSQVIKCD
PDCLRACQEQIEALLESSLRQAQQHSAAAAPKNVEEEGGLSYTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgctgtgctgcgaggtggagaccatccgccgggcgtacctcgatgcc
aacctcctgaacgaccgagcgctgcagaccatgctcaaagccgaggagacatgctcgccc
tccgtgtcgtacttcaagtgcgtgcagaaggacatcctgccctacatgcgcaagatcgtg
gccacctggatgctcgaggtgtgcgaagagtagaaatgcgaaagagaagtcttcctctcg
gccctgaactattcggaccgggttctgtccctggagcccgtgaagaaaagccggctgtag
gtgccgggggccacttgcatgttcggggggtccagaatgaaggagactcttcctcctgac
ggccgaaaattggcatcttctcctcaccacccggggccgcctcaggagctctctcacatg
gagctgctcctggtgaacaagctgaagtggcacctcgccgccatgaccccccacgacttc
atcgaacactttctgtccaagatgccggtgctggaggagaacaagcagatcatccgcaag
cacgcgcagaccttcgtggccctctgcgccaccgacgtgaagttcatttccaacccccct
tccatgatcgccgcgggcagcgtggtcgccgccgtccagggcctgcacttggggagcacc
aactccttcctgacctaccagcgcctcacccgcttcctgtctcaagtcattaagtgtgac
ccggattgcttgcgagcctgccaggagcagatcgaagccctcctcgagtcgagcctgcgc
caggcccagcagcacagcgcggcggcggcgcccaagaacgtggaggaggagggaggcctg
tcctacacgcccaccgacgtgcgagacgtgaacatttga

DBGET integrated database retrieval system