KEGG   Monodelphis domestica (opossum): 100014864Help
Entry
100014864         CDS       T01031                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mdo03012]
    100014864 (TUFM)
   03029 Mitochondrial biogenesis [BR:mdo03029]
    100014864 (TUFM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100014864 (TUFM)
Translation factors [BR:mdo03012]
 Eukaryotic Type
  Elongation factors
   100014864 (TUFM)
 Prokaryotic Type
   100014864 (TUFM)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100014864 (TUFM)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100014864 (TUFM)
  Exosomal proteins of breast cancer cells
   100014864 (TUFM)
  Exosomal proteins of colorectal cancer cells
   100014864 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 100014864
NCBI-ProteinID: XP_007499522
Ensembl: ENSMODG00000015564
LinkDB All DBs
Position
6
AA seq 456 aa AA seqDB search
MAATVMFRARPGPTVFQNFQLLHKFLKQAQLSNPGQKPSLPLLSRSLAVEAKKTYVRDKP
HINVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYS
TATRHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHM
VVFVNKADAVQDNEMVELVELEIRELLTEFGYDGEKTPVIVGSALCALEQRQPELGVNAV
MKLLDAVDTHIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGTVKKGDECEFLGHS
KNFRSVVTGIEMFHQSLERAEAGDNLGALIRGLKREDVRRGMVMVKPGSIQTHQKVEAQV
YILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVLLPPEKEMAMPGEDLKLNLILRQPMIL
EKGQRFTLRDGGKTIGTGLVTNISAMTEEDKDIKWS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaccgttatgttccgtgcacggcccgggcccaccgtttttcagaacttccag
ctgctgcacaagtttttgaaacaggcccaactttctaacccagggcagaagccctccctt
cccttgctttcacggagccttgctgttgaggccaagaagacttatgtgagagacaaaccc
catattaatgttggcacaattggccatgtggatcatggcaagactacattgacagcagca
atcaccaagattttggcagagggtggtggggccaagtttaagaagtatgaggagatcgac
aatgcaccagaagaacgagccaggggaattaccatcaatgcagcccatgtggaatatagt
acagccacccgacactatgcccatactgactgtcctggccatgctgactatgtcaagaac
atgattactggcacagccccactggacggctgcatcctggtggtggcagccaatgatggc
cccatgcctcagacaagggagcacctgctgcttgccaaacagattggtgtggagcacatg
gtagtgttcgtgaacaaggcagatgctgtccaggacaatgagatggtggaactagtagag
ctagaaataagggagctgcttactgaatttggctatgatggggagaagactcctgtcatt
gttggttctgccctctgtgcccttgagcaacggcagccagagttaggggtgaatgctgta
atgaaactgttggatgctgtggacactcatattcctgtgcctactcgggatctagagaag
cccttcctgctgccggtggagtctgtttactccatccctggccgaggcacagtggtgaca
gggactctggaaagaggaactgtgaagaagggagatgaatgtgaatttctgggtcacagc
aagaattttcgctctgtggtcacaggaattgaaatgtttcatcagagtctggaacgagct
gaggctggagataatcttggtgcattaattcgggggctgaagagagaggatgttcgacgg
ggcatggtgatggttaaaccaggctccattcagacccatcagaaggttgaggctcaggtt
tacattctcagcaaggaggaaggtggccgccacaagccatttgtctcacacttcatgcct
gtcatgttctctcttacatgggatatggcctgccgggtccttctgccaccagagaaggag
atggccatgcctggagaagatctgaaactaaacttaatcttaagacaacccatgatcttg
gagaaaggtcagcgttttaccctgagggatggtggtaaaaccattggtactggcctggtc
actaatatatctgctatgactgaagaagataaggacatcaagtggagctga

DBGET integrated database retrieval system