KEGG   Monodelphis domestica (opossum): 100014923
Entry
100014923         CDS       T01031                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04012  ErbB signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04110  Cell cycle
mdo04151  PI3K-Akt signaling pathway
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04934  Cushing syndrome
mdo05162  Measles
mdo05165  Human papillomavirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05202  Transcriptional misregulation in cancer
mdo05203  Viral carcinogenesis
mdo05206  MicroRNAs in cancer
mdo05215  Prostate cancer
mdo05220  Chronic myeloid leukemia
mdo05222  Small cell lung cancer
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100014923 (CDKN1B)
   04066 HIF-1 signaling pathway
    100014923 (CDKN1B)
   04068 FoxO signaling pathway
    100014923 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100014923 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100014923 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100014923 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100014923 (CDKN1B)
   05206 MicroRNAs in cancer
    100014923 (CDKN1B)
   05203 Viral carcinogenesis
    100014923 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100014923 (CDKN1B)
   05220 Chronic myeloid leukemia
    100014923 (CDKN1B)
   05215 Prostate cancer
    100014923 (CDKN1B)
   05222 Small cell lung cancer
    100014923 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100014923 (CDKN1B)
   04934 Cushing syndrome
    100014923 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100014923 (CDKN1B)
   05169 Epstein-Barr virus infection
    100014923 (CDKN1B)
   05165 Human papillomavirus infection
    100014923 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100014923 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100014923
NCBI-ProteinID: NP_001265866
Ensembl: ENSMODG00000018225
UniProt: F6PGI2
LinkDB
Position
8
AA seq 199 aa
MSNVRISDGSPTLERMEGRPAEYPKPSACRNLFGPVNHEDLTQDLKKHCRDIEEDCQRKW
NFDFRNHKPLEGSYEWQPVEKDSLPEFYFRPPRNPKGGCQGPVQENGDLNGVRPAGFFIA
SQGISEDTHLRDQKTEGASESQTSLADQCTERRKRPATDDVSPQNKRANIKEEEVSDTSP
NASSVEQTPKKPSLRRHQT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgtatttctgatgggagcccgaccctcgagcggatggaaggcaggccg
gcggagtaccccaaaccctcagcttgccgcaacctcttcggcccagtgaaccatgaagat
ttaacgcaggacttaaagaagcattgcagggacatcgaggaggattgccagcgcaagtgg
aactttgactttcggaatcacaagcccttggaggggagttatgagtggcaacctgtggag
aaagacagtttgcccgagttttatttcaggcccccgcggaaccccaaagggggatgccag
ggtcccgtccaggagaacggggatcttaacggagtgcgcccagcggggttttttattgct
tctcagggaatctcagaggacacccacttaagagatcaaaaaactgagggtgcatccgaa
agccagacgagtttggcagaccagtgcacagagaggaggaaacgaccggccacggatgat
gtctcacctcaaaacaaaagagccaacattaaagaagaagaggtttcagacacttctccc
aatgctagttcagtggagcagacgcccaagaagcccagtctcagaagacatcaaacgtaa

DBGET integrated database retrieval system