KEGG   Monodelphis domestica (opossum): 100015984Help
Entry
100015984         CDS       T01031                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00051  Fructose and mannose metabolism
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo00520  Amino sugar and nucleotide sugar metabolism
mdo00524  Neomycin, kanamycin and gentamicin biosynthesis
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo04066  HIF-1 signaling pathway
mdo04910  Insulin signaling pathway
mdo04930  Type II diabetes mellitus
mdo04973  Carbohydrate digestion and absorption
mdo05230  Central carbon metabolism in cancer
Module
mdo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100015984 (HKDC1)
   00051 Fructose and mannose metabolism
    100015984 (HKDC1)
   00052 Galactose metabolism
    100015984 (HKDC1)
   00500 Starch and sucrose metabolism
    100015984 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100015984 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100015984 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100015984 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100015984 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100015984 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100015984 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100015984 (HKDC1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100015984 (HKDC1)
Membrane trafficking [BR:mdo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100015984 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100015984
NCBI-ProteinID: XP_001364147
UniProt: H9H6E5
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLLAFYFTKLKEDQIKKVDRFLYHLRLSDDTLLDIMTRFRAEMEKGLGKDTNPTAC
VKMLPTFVRAIPDGSEKGEFLALDLGGSKFRVLTVRVSEEGKPNVHMESQIYPTPKEIIH
GSGSELFDYVADCAADFVKTRDLAHKKLPLGLTFSFPCQQSKLEEGILLSWTKKFKVRGV
QDTDVVSSLTRALRRHQDVDVDVLALVNDTVATMMTCAYDDPRCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMAINTEWGAFGEDGALEDIRTEFDRELDLGSINPGKQLFEKMISGL
YIGELVRLILLKMTKAGLLFQGEKSSALHTKGKIETRHVALMEKYKEGLQNTREILRELG
LEPSEEDCVAVQHVCTIVSFRSANLCAAALAAILNRLRENRRLTRLRTTVGMDGTLYKTH
PQYPKRLHKVVRKLVPNCDVRFLLSESGSAKGAAMVTAVAARVQAQRKVIDEVLALFQLT
REHLVSVKNKMRSEMEYGLKKETQPLATVKMLPTYVCAMPDGTEKGKYLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGIKGASKLPLGF
TFSFPCKQNCLDKGILVEWTKGFKATDCEGEDVVDMLREAIKRRNEFELDVVAVLNDTVG
TMMTCAYEDPACEIGLIAGTGSNVCYMEEMRNIELVEGDEGIMCINTEWGGFGDNGCLDE
IRTQYDVEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKHGLLFRGQISERLRTRG
IFETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAA
IVEKRREDRGLERLAITVGVDGTLYKLHPHFSRILRETVHALAPRCDVTFMLSEDGSGKG
AALITAVAKRLHLKKDH
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccgtccacttgctggctttctatttcacaaagctgaaagaagatcagattaag
aaggtggacaggtttctgtatcatctgcggctctccgatgacaccctcctggacatcatg
acccgcttccgcgccgagatggagaagggcctcgggaaggacaccaaccccactgcctgt
gtgaagatgctgcctacttttgtcagggccatcccagatggctcagagaagggagagttc
ctcgctctggacctcggcggctccaagttccgtgtgctgacggttagagtttccgaagag
ggcaagccgaatgttcacatggagagtcagatctacccgacccccaaggagatcatccac
gggagcggttctgagctctttgactacgtggccgactgtgcggctgatttcgtgaagacc
cgagacctggcccacaagaagctgcctctgggcctgacgttctcctttccgtgtcagcag
agcaagttggaggaggggatcctgctttcgtggacgaagaagtttaaggttcggggcgtg
caggatacggacgtggtgagcagcctgaccagagctctgaggaggcaccaggacgtggac
gtggatgtgctggctctggtcaatgacacggtggccaccatgatgacgtgcgcctacgac
gacccgcgctgcgaagtgggagtcatcatcggcaccggcaccaacgcctgctacatggag
gacatgagcaacatcgacctggtggagggggacgagggccgcatggccatcaacaccgag
tggggggccttcggggaagacggcgccttggaggacatccgcaccgagtttgacagggag
cttgatttggggtccatcaatccagggaaacagctgttcgagaagatgatcagcggcctg
tacatcggggagctggtcaggctcatccttctgaagatgaccaaggctggcctcctgttc
cagggcgagaaatcctcggccctccacaccaagggcaagatcgagacgagacacgtggcc
ttgatggagaagtacaaggaggggctccagaacaccagggagatcctcagggagctgggc
ctggagccttcggaagaagactgcgtggcggtccagcacgtctgcaccatcgtctccttc
cgatcggccaatctctgcgccgcagccctggccgccatcttgaaccgcctgcgggagaac
aggaggctgacccggctcaggaccaccgtgggaatggacggcacgctctacaaaacccac
cctcagtacccaaagcgtttacacaaagtggtcaggaagctggtccccaactgtgatgtc
cggttcctcctctctgagagcggcagtgccaagggggcagccatggtgaccgctgtggct
gctcgggtacaggcccagaggaaggtgattgacgaagtgctggccctgttccagctgacc
cgagagcacctggtaagcgtgaagaacaagatgaggtctgagatggagtacgggctgaag
aaggagacccagccgttggccacggtgaagatgctgcccacctacgtctgtgccatgcca
gatgggacagagaagggcaagtacctcgccttggatctgggaggcaccaatttccgggtc
ctcctggtgaagatcagaagcggacggagatcagtgagaatgtacaataagatcttcgcc
atcccgctggagatcatgcagggcacgggggaagagctgttcgaccacatcgtgcagtgc
atcgccgacttcctggattacatgggcatcaagggagccagcaagcttcccctgggcttc
acgttctcgtttccctgcaagcagaactgccttgataaggggatccttgtggaatggacc
aaggggttcaaagccacagactgtgagggggaagatgtcgtggacatgctcagggaagcc
attaagaggagaaatgaatttgaactggatgttgtggcggtgctcaatgacactgtggga
accatgatgacgtgtgcttatgaagacccggcctgtgagatcggcctcattgcaggaacg
ggcagcaacgtgtgctacatggaggagatgcggaacatcgagctggtggaaggcgacgag
gggatcatgtgcatcaacaccgagtggggaggattcggggacaacggctgcctggacgag
atcaggacccagtacgacgtcgaagtggacgagggctccttgaaccccggcaaacagagg
tatgagaagatgaccagcggcatgtaccttggggagatcgtgaggcagattctgatcgac
ctgaccaagcacggcctcttgttccgagggcagatttcggagcggctgcggaccagaggc
atatttgagaccaagttcctgtctcagatcgaaagtgaccgcctggccctcctccaggtc
cggaggatcctgcagcagctgggcctggacagcacctgcgaagacagcatcgtggtgaag
gaggtgtgcggggccgtgtcccggcgggcggcccagctctgcggcgccggcctggccgcc
atcgtggagaagcgaagggaggaccgcggcctggagcgcctcgccatcacggtcggcgtg
gatgggaccctctacaagctgcaccctcacttttctcggatcttgcgggagacggtgcac
gcgctggctccacggtgcgacgtcacattcatgttgtccgaagacggcagcggaaagggg
gccgccctgatcacggccgtggccaagaggttgcacctgaagaaggaccactga

DBGET integrated database retrieval system