KEGG   Monodelphis domestica (opossum): 100016391Help
Entry
100016391         CDS       T01031                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo05164  Influenza A
mdo05202  Transcriptional misregulation in cancer
mdo05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100016391 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    100016391 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    100016391 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdo01002]
    100016391 (TMPRSS2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100016391 (TMPRSS2)
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100016391 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a DUF2318 SKG6
Motif
Other DBs
NCBI-GeneID: 100016391
NCBI-ProteinID: XP_007493127
Ensembl: ENSMODG00000020961
LinkDB All DBs
Position
4
AA seq 503 aa AA seqDB search
MALNTGPPVFGPYYENHGYQVEHYPPEHLVNAYVPYPASYCPPAVPQYIPRVLTHTSAPA
AAHLQPKSSSGIVCTSRAKRAVCVAVSVGVIVVGAVIATVFLWKFVKNSCPNSGIECGTS
GTCISPANWCDGISHCPSGEDENHCVRLYGPKFILQIYSSHNKSWYPVCQDGWNDNYGKI
ACKDMGYNVNSFYSSRGIIDDSGTTSYMKLNLSAGNVDLYEKLYNSNVCFLRTVVSLRCI
ECGTVMKVNQLNRIVGGTNAAPGEWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPL
SNPRYWTAFAGILRQSVMFYGSGYKVQKIISHPSYDSNTKNNDVALIKLQTPLTFNEKIR
PVCLPNPGMMFEPTQSCWISGWGATHEKGRTSDILNAVMVPIIEPWKCNSRYVYNNMITP
AMICAGYLRGKIDSCQGDSGGPLVTEKNSVWWLVGDTSWGSGCAKANRPGVYGNLTVFTD
WIYQQMQILEIGGEIGLKTPLST
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaatacagggccaccagtatttggaccatattatgaaaaccatggttaccaa
gtggaacattatcctccagagcaccttgtgaatgcttatgtaccttacccagcttcatat
tgtcctccagcagtgcctcagtacatcccaagagttctcactcatacttcagcaccagca
gcagcccatttacaacctaaatcttcatctgggatagtgtgtacttcaagagctaagaga
gcagtgtgtgttgccgttagcgttggagtaatagtagttggtgctgtgattgcaaccgtt
tttctttggaagtttgtgaaaaatagctgcccaaattctggaatagaatgtggaacctca
ggaacttgtattagtccagctaactggtgtgatggaatatcacattgtcccagtggtgaa
gatgagaaccactgtgttcgcctctatggaccaaaatttatccttcagatttactcatct
cataacaaatcctggtatcctgtatgccaagacggctggaatgataactatgggaagata
gcatgcaaagacatgggatataacgtgaatagtttctactccagtcgaggaataatagat
gatagtggcaccacaagctatatgaagttgaacctgagtgctggaaatgtagatttatat
gaaaaactctacaacagcaatgtctgttttctcagaacagtggtttctctccgatgcata
gaatgtgggacagtgatgaaggtgaatcagttgaaccggattgtaggtgggaccaatgct
gctccaggagaatggccgtggcaagtcagccttcacgttcaaggcgtccatgtctgtggt
ggctctattatcactccggaatggattgtaacagcagctcattgtgttgaagaacctctt
tctaatccccggtactggacagcatttgcaggaattttgaggcagtctgtgatgttttat
ggaagtggatataaagtgcaaaaaataatttctcatccaagttatgattcgaataccaag
aacaatgatgttgccctcataaagttgcaaacaccactcacatttaatgaaaaaataaga
ccagtatgtttgcctaatccaggaatgatgtttgaacccactcagtcatgctggatatca
ggatggggtgcaacccatgaaaaaggcaggacttcagacatcttgaatgcagttatggtg
cccataatagaaccttggaaatgtaatagccggtatgtctacaataacatgattactcct
gccatgatttgtgctggttacctcagagggaaaatcgactcctgccagggtgacagtggg
ggtccgttagtcactgagaaaaattcagtatggtggttagttggtgatacaagctgggga
tctggatgtgccaaggcaaacagacctggagtttatggaaacctgacagtatttacagac
tggatttaccaacaaatgcagatattggaaattggaggagaaattggattgaagactcca
ctgtcaacctga

DBGET integrated database retrieval system