KEGG   Monodelphis domestica (opossum): 100017470Help
Entry
100017470         CDS       T01031                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00350  Tyrosine metabolism
mdo01100  Metabolic pathways
Module
mdo_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100017470 (GSTZ1)
Enzymes [BR:mdo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100017470 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100017470
NCBI-ProteinID: XP_001367277
Ensembl: ENSMODG00000005427
LinkDB All DBs
Position
1
AA seq 217 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDYDIVPINLVKDGGQQYSKEFETLNPMKQVP
TLKIDGITITQSLAIIEYLEETRPTAPRLLPLDPKERASVRMISDLIASGIQPLQNLSIL
KKVGQETQLAWAQAVISSGFKALESVLQSTAGKYCLGNEISMADLCLVPQVANAERYKVD
LSPYPTITRIYKTLLTVEAFQVSHPSRQPDTPPELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaggaaagccaatcctctattcttatttccgaagctcctgctcctggagagtt
cgaatagccctagctctcaaggggatcgactacgacatcgttcccatcaacctcgtaaag
gatggggggcaacagtattctaaggaattcgagacattgaaccccatgaaacaagtgcca
accctgaagatcgacggcattaccattacccagtcactggctattattgagtatctggaa
gaaacacgaccgacagcccccaggctcctgccgctggaccccaaggaaagggccagtgtc
cgcatgatctcagacctcattgctagtggaattcagcccctgcagaacttatctatccta
aagaaagtgggccaagaaactcagctggcatgggcacaggcagtcatcagttctggcttt
aaagccttagagagtgtcctgcagagcacagcagggaagtactgcctgggaaatgagatc
tccatggctgacttatgcctggtacctcaggtggctaatgctgaaaggtataaggtggac
ctctccccataccccaccatcacacgcatttacaagaccttgctcactgtcgaggctttc
caagtgagccatccttctcggcagcctgacacccctccagaacttcgagcttaa

DBGET integrated database retrieval system