KEGG   Monodelphis domestica (opossum): 100017762Help
Entry
100017762         CDS       T01031                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04020  Calcium signaling pathway
mdo04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100017762 (CACNA1E)
   04020 Calcium signaling pathway
    100017762 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100017762 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mdo04040]
    100017762 (CACNA1E)
Ion channels [BR:mdo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100017762 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 100017762
NCBI-ProteinID: XP_016284988
Ensembl: ENSMODG00000006729
LinkDB All DBs
Position
2
AA seq 2365 aa AA seqDB search
MIKALCYMGEEERKEERKLKKRNLVLKELVFYGRKYNTYKERCAVMVPDMHGLSPCPAYK
SQELIPALATGESPELGVSTHRHILALPEEETWRQHGPGMMATQTSALLDPEALEETGAL
PGSPRALCFDASSVFFPMQEGEGSGWEGSGALDASLSPFLPVSPEVMKRRRGGLIEQRDI
IKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGEGDSDQSRNRQGTPVQSAGASAAY
KQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATI
IANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNG
WNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMV
PLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGVLEGFDPPHPCGVQGCPEGYEC
RDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGS
FFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEEN
KNSGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFR
HKERLLRISIRHMVKSQVFYWMVLSVVALNTACVAIVHHDQPLWLTHLLYYAEFLFLGLF
LLEMALKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRI
FKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSAN
FDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFL
AIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMW
EPRSSHLYVCTCLCVVSGYVWSQGHCHLCPCRGQSESTCMCAPAGMCSVPRCCVCVCTAA
YLSKPLPPLQCPHVVHFTAVGTDGPQQTSARLWRRPSSASGDTPALLLTAGQGRILSRDT
TNSLMVPGGCGLSTVADEIRAPLVLSPPDLETGKDTALTEQEQEGTSEQALLDDVQLDMG
RAISRSEPDLSSITANVEKGTESTSVTVAIPEVGTLVDSTVVHISNKTDGEASPLKEAEI
KEDGEEIEKKRKKEKSSSTGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIA
ASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNI
LDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVT
SLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVK
GREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYV
VYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNR
HTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTIVFSLE
CILKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLI
KLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN
NFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYFYFV
SFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEM
YEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKG
GADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTIGKIYAAMMIMDYYKQSKIK
KQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGYPSMSPLSPQ
EIFQLACMDPNHGEFQEQQSLVVTDPSSMRRSFSTIRDKRTNSSWLEEFSMERSSENTYK
SRRRSYHSSLRLSAHRLNADSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGAQ
GDWESPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRP
LLSYSSLMRHPGSISPPYDGSEIGSPLPSKGLESNDACLTESSSSPQAKQSQPSTPQRYI
SEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRR
GGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 7098 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggcactatgctacatgggagaggaagaaagaaaagaagagaggaagttaaaa
aagagaaatcttgtcctcaaggaacttgtattctatgggaggaaatacaacacatacaaa
gagcgatgtgctgtgatggtgccagatatgcatggactcagcccgtgcccagcctacaag
tcccaggagctcatcccggccttggccactggggaaagccctgagcttggtgtttccacc
caccgacacatcctagccctgcctgaagaagagacatggcgccagcatggcccaggcatg
atggccacccagacttctgctctgctggatcccgaggccctggaggagacaggggcccta
ccaggatccccacgtgccctatgcttcgatgcctcttctgtcttcttccccatgcaggag
ggtgagggctctggatgggaaggcagtggtgctctggatgccagtttgagcccattcctc
cctgtgagtccagaggttatgaagcggaggcggggagggctcattgaacagagagacatc
atcaaggcccatgaagcccacaagatgcagagtacacctcaggcccggaggaaagaatgg
gagatggctcgctttggggaggctgtggttggcaggccaggatcgggagaaggagactcg
gaccagagcaggaaccggcaaggaacaccagtgcagtccgccggggcatcggccgcctac
aagcaatccaaagcccagagggccaggactatggctttatacaaccccattccggtcagg
cagaactgtttcaccgtcaacagatccctgtttatcttcggagaagataacattgtcagg
aaatatgccaagaagctcatcgattggccgccatttgagtatatgattctggctacaatc
attgccaactgcatcgtcttggccttggagcaacatctcccagaggatgacaagactccg
atgtctagaagattggagaagactgaaccatatttcattgggattttttgctttgaagct
gggattaaaattgtggccctggggtttatcttccataagggctcatatcttcgcaatggt
tggaatgtcatggacttcattgtggtcctcagtggcatcctggccacagctggtacccac
ttcaatacccatgtggacctgagaacccttcgggctgtgcgagtactgaggccattgaaa
cttgtttcaggcattcccagtttgcaaatagtgctgaagtccatcatgaaggcaatggtg
cctctgctccagattggccttcttctgttctttgccatcctgatgttcgccatcattggc
ctggagttttatagtgggaaactacacagagcctgctttatgaacaattcaggtgtgctg
gaggggtttgaccctcctcatccatgtggggtacagggctgcccagagggttatgagtgc
agagactggattggccctaatgatgggatcactcagtttgacaacattctctttgctgtg
ctgaccgtcttccagtgtataaccatggaaggatggactaccgtgctgtacaataccaat
gatgccttaggagccacctggaattggctgtacttcatccccctcatcatcatcggatcc
ttctttgttctcaaccttgtcctgggagtgctttccggggaatttgccaaagaaagagag
agagtggagaaccgtagagcctttatgaaactgcggagacagcaacaaattgaacgggaa
ttgaatgggtatcgagcctggatagataaagcagaggaagtgatgctggctgaagaaaac
aaaaattctggaacatcagctttggaagtgctccgaagggcaaccattaaaaggagtcgc
actgaagccatgactcgtgactcaagtgatgaacactgtgttgacatctcctctgtgggc
actcctcttgctcgtgccagtataaaaagtactaaagtagatggagcctcctatttccgg
cacaaggagcgacttctgcgaatttccattcgtcatatggtcaaatcccaggttttttac
tggatggtcttgagtgtcgtggctctcaacactgcatgtgtggctattgtccatcatgac
cagcctctgtggctcactcacctcctctactatgcagagtttttgtttttgggactcttc
ctcttagaaatggccctgaagatgtatggcatggggccacgcctttattttcattcctcc
ttcaattgctttgattttggggtcactgtgggaagtatctttgaagtggtttgggccatc
tttagacctggcacctctttcggaatcagtgtcttgagggctcttcgacttctaagaata
tttaaggttactaagtactgggcatccctacggaatttagtggtctcactgatgagctcc
atgaaatccattatcagcttactcttccttctcttccttttcattgtcgtctttgctctg
ttgggaatgcagctctttggaggcagatttaattttaatgatggaactccttcagcaaac
tttgacaccttccctgcagccattatgacagtattccagattttgacaggtgaggactgg
aatgaagtcatgtacaatgggatccgctcccagggtggagttagctctggtatgtggtcc
gctatctacttcatcgtactcactctttttggaaactacaccctactgaatgtgtttttg
gccatcgctgttgacaatttggccaatgctcaggagctgacaaaggatgagcaggaggaa
gaagaagccttcaatcagaagcatgcattacaaaaagccaaggaagtcagcccaatgtct
gcacctaacatgccttctattgaaagagacagaaggaggagacaccacatgtcgatgtgg
gagccacgcagcagccacctgtatgtgtgtacatgtttgtgtgttgtgagtggttatgtg
tggtcccagggacattgtcacctttgtccttgccgtggacaaagtgaatcaacgtgtatg
tgtgcaccggcgggaatgtgttctgtgcctcggtgttgtgtgtgcgtgtgcaccgccgcg
tacctttcaaagcccctgcccccgctccaatgcccacatgtagtccatttcacagcagta
ggcactgatggaccccagcagactagcgcccggctctggagacgaccgtcctctgcatcg
ggcgacaccccagccctcctcctgacagccggacagggacgcatcctctcccgggacaca
accaatagccttatggtccctggaggctgtggattgtcaacagttgctgatgaaataagg
gcccctctggtcctctctcctccagacttagaaacaggaaaggataccgccctcactgag
caggagcaggagggtaccagtgaacaagccttgctggatgatgtgcagctggatatgggc
cgggccattagtcgaagcgagcctgacctttcctccataacagctaatgtggagaagggc
actgagagcaccagcgtcaccgtcgccattcctgaagttggcaccttggtggactccact
gtggtgcacattagtaacaagacagatggagaagccagccccctgaaagaggcagagatt
aaagaggatggagaagaaattgagaagaagagaaagaaggaaaagagctcaagcacaggc
aaagcaatggtgccccatagctccatgttcatcttcagcaccactaatccgatccgaagg
gcatgccactacattgtgaatcttcgctactttgagatgtgcatccttttggttattgca
gccagcagcattgccttggctgcagaggatcctgtcctaaccaactctgagaggaacaaa
gtcctaagatattttgactatgttttcactggtgtgttcacctttgagatggtcataaag
atgatagaccagggcttgattctgcaggatggatcctacttcagggacctgtggaatatc
ctggactttgtggtggtagtcggggcactagtggcctttgctttggcgaacgctctggga
accaacaaaggccgggatattaaaactattaagtctctgcgcgtgctccgagttctgagg
ccactgaaaaccatcaagcgcttacccaagcttaaggctgtctttgactgtgtagtgacc
tccctgaagaatgtattcaacatactcattgtctacaagctcttcatgttcatctttgct
gtcattgcagtccaactctttaaggggaaattcttttattgcacagacagctccaaagat
acagaaaaggaatgcataggcaactatgtagatcatgagaaaaacaagatggaggtaaag
ggccgggaatggaaacgccatgagttccactatgacaacatcatttgggctctgttgacc
cttttcactgtgtccacaggggagggctggccacaagttttgcagcattctgtggatgtg
actgaggaagaccggggcccaagccgtagcaaccgcatggaaatgtccattttttacgtg
gtatatttcgtagtcttccccttcttctttgtcaacatctttgttgccctcatcatcatt
accttccaggagcaaggggacaagatgatggaggagtgcagcctggaaaaaaatgagagg
gcatgcattgactttgccatcagtgccaaaccgctgacccgctacatgccccagaaccgt
catacctttcagtaccgtgtctggcacttcgtggtatccccatccttcgaatacaccatc
atggccatgattgccttgaacaccgtggtgctcatgatgaagtattattctgctccctgt
acctacgaactggcactaaagtatctgaacattgcattcaccattgtgttctccctggaa
tgcatcttgaagatcatcgcttttggcttcttgaattatttccgagacacctggaacatc
tttgatttcatcacagtcatcggcagcatcacagaaattatcctaacagacagcaagctg
gtgaacaccagtggcttcaacatgagttttctaaagctcttccgagctgcccgtctcatc
aagctccttcgacagggatataccatccgcattttgctgtggacttttgttcagtccttt
aaggctctcccctatgtctgtctgttgattgctatgcttttcttcatttatgccatcatt
gggatgcaggtctttggaaatataaaattagatgaagagagtcacattaatcgacacaac
aacttccgcagtttttttgggtccctgatgctgctcttcaggagtgccacaggtgaggca
tggcaggaaattatgttatcatgtctgggagaaaaaggctgtgagccggacaccactgca
ccctcagggcagaatgagaatgaacgctgtggcactgatctggcctacttttactttgtt
tctttcatcttcttctgctcctttttgatgcttaatttgtttgtggctgttatcatggac
aactttgagtacctgacacgggactcatctatccttgggcctcatcatttggatgaattt
gtccgagtctgggcagagtatgatcgagctgcgtgtggccgcatccattacactgagatg
tatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccctccaaa
gtggcgtataagagattggtactgatgaacatgccagtagcagaggacatgactgtccac
ttcacttccacattaatggccctaattcggacagctctggacatcaagattgcaaaaggt
ggtgcagacaggcagcagctagattcagaactacaaaaggagaccctggctatctggcct
cacctttcccagaagatgctggatctgcttgtacccatgccaaaagcctcagacttaacc
attgggaaaatatatgcagccatgatgatcatggactactataagcagagtaaaataaag
aagcagaggcagcagctggaagaacagaaaaatgctcccatgttccagcgaatggaaccc
tcatctttgcctcaggagatcatttctaatgccaaagccctgccttacctccagcaggac
accctttcaggcctgagcagtcggagtgggtacccatctatgagtccactctccccccag
gaaatattccagttggcttgcatggacccaaaccatggggagttccaagagcagcaatct
ctggtggtgaccgacccaagttccatgagacgttccttttccactatcagagacaaacgc
acaaactcctcttggttagaggaattttcaatggagcgaagcagtgaaaacacctacaag
tcccgccgacgcagttatcattcttctttgcgcctgtcagctcaccgtctaaatgctgac
tcaggccacaaatctgatacccatcgctcaggaggcagagaacgtggccgatcaaaagaa
cgtaagcacctgctgtctcccgacgtgtcccgctgcaactctgaagaacgaggtgcccaa
ggggactgggagtctcccgagcggcaccagtctagatcacccagtgagggcaggtctcag
acacccaacagacagggtacaggctcccttagtgaaagctccattccttctatctctgac
accagcaccccacgtcgaggtcgtcggcagcttccacctgttccccctaaaccccggcca
ctcctctcctacagttccttgatgcgacatcctggtagtatctctccaccctatgatggg
agtgaaattggttccccactgccctccaagggccttgagagcaacgatgcctgcctgact
gagtcttccagctcaccacaagcaaagcagagtcagccctccactccccagcgctatatc
tcagagccctacctggctttgcatgaagactcccatgcctcggactgtggcgaggaggaa
acactcacctttgaggctgctgtggctaccagcctgggccgctccaacaccattggctca
gcccctcccctgaggcacagctggcagatgcccaatgggcactaccggaggcgtaggcgt
ggaggaccagggccagggatgatgtgtggggctgttagtgatcttctgagtgacacggaa
gaggatgacaaatgctag

DBGET integrated database retrieval system