KEGG   Monodelphis domestica (opossum): 100017822Help
Entry
100017822         CDS       T01031                                 

Gene name
NAPEPLD
Definition
(RefSeq) N-acyl phosphatidylethanolamine phospholipase D
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100017822 (NAPEPLD)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     100017822 (NAPEPLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Trypan_PARP Lactamase_B SPESP1
Motif
Other DBs
NCBI-GeneID: 100017822
NCBI-ProteinID: XP_001371260
Ensembl: ENSMODG00000017219
LinkDB All DBs
Position
8
AA seq 501 aa AA seqDB search
MVRLRALGSYLGLLALGTTSRSDASVTCGKRRQTLWTGGGWEPPCGTASKLLEPGGKMEP
PREEEREPEPEPEPEREPEPELVREPESERERQEAKISGLERSSTNNMEEKQNESQNFRT
SNSCLSEEVGTCKESTRCSRNDAEKSFRKSFRLDYRLEEPVTKSQKGKDGRYINPWPTWK
HPSLPSVLKWIIMEKDNSKIPRCKEELDKELPVLKPYFVDKPEHVGMKKGGLRVTWLGHA
SVLVEMDEIIFLTDPIFSMRASLMQFIGPKRFRHPPCTVNQLPKIDAVLISHTHYDHLDY
NTVLSLNERFGCELRWFVPIGLLEWMQNCGCENVIELDWWEENCIPGHDDVTFVFTPSQH
WCKRTPIDDNKVLWGSWSVLGPWNRFFFAGDTGYCTAFEEIGKRFGPFDLAAIPIGAYEP
RWFMKYQHVDPEEAVRIHIDVQAKKSVAIHWGTFALANEYYLDPPMKLKESLERYGINNE
DFFVLKHGESKDIKTDEENLD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgagactccgggctctgggaagctacctaggattgttggctctcgggaccaccagc
cggtccgacgccagcgtaacctgtgggaagaggcgtcagaccctctggactggcggtggt
tgggagccaccttgcgggaccgcaagcaagctgctggagcctggaggcaagatggagcca
ccgcgggaggaagagcgcgagcccgagcctgagcctgagccggagcgcgagcccgagccc
gagctggtgcgcgagcctgaatcggagcgcgagcgccaagaggctaagatcagcggactg
gagagatcttcaacaaacaatatggaagaaaagcaaaatgaaagccagaattttagaaca
agtaatagctgcctctctgaagaagtgggaacatgtaaggaatcaaccagatgtagcaga
aatgatgctgagaaatcattcagaaaaagcttcagactagactatagattagaggaacct
gtaactaagtcacagaaaggaaaggatggaagatacatcaacccttggccaacatggaaa
catccatctcttccaagtgttctgaaatggataataatggaaaaagataacagcaaaatt
ccacgttgtaaagaggaattggacaaagaacttccagtgcttaagccctattttgttgac
aaacctgaacatgttggaatgaagaaaggtggtttacgcgtcacctggcttggacatgca
tcagttttggtggaaatggatgaaataatatttctcactgaccctattttcagtatgcgg
gcttcattgatgcagttcattggtccaaaacgctttcgccatccaccatgtacagtaaat
cagcttcccaaaatagatgcagttctaatcagtcatacccactatgaccacttggactat
aacactgtacttagtttaaatgagcgctttggctgtgagctgagatggtttgtacctata
ggtctcttagagtggatgcagaattgtggctgtgagaatgtgattgagctggactggtgg
gaagagaactgtattcctggacatgatgatgttacctttgtctttacaccttcccaacac
tggtgtaaaaggactccgatagatgacaataaagttttgtggggcagctggtctgtcctg
gggccttggaatagatttttttttgcaggagacactggttattgtaccgcttttgaagag
ataggaaaacgatttggaccttttgatcttgcggctattcccattggtgcttatgaacca
aggtggtttatgaaatatcagcatgtagaccctgaagaagctgtaaggattcacattgat
gttcaagccaagaagtctgtagctattcactggggaacctttgccttagcaaatgagtat
tacttggatcctcctatgaaattgaaagaatctctagagaggtatggaatcaacaatgaa
gattttttcgtcttgaagcatggagaatcaaaagacataaagactgatgaggaaaacctt
gactaa

DBGET integrated database retrieval system