KEGG   Monodelphis domestica (opossum): 100017915Help
Entry
100017915         CDS       T01031                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00250  Alanine, aspartate and glutamate metabolism
mdo00410  beta-Alanine metabolism
mdo00430  Taurine and hypotaurine metabolism
mdo00650  Butanoate metabolism
mdo01100  Metabolic pathways
mdo04727  GABAergic synapse
mdo04940  Type I diabetes mellitus
Module
mdo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100017915 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100017915 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100017915 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100017915 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100017915 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100017915 (GAD1)
Enzymes [BR:mdo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100017915 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100017915
NCBI-ProteinID: XP_001367783
Ensembl: ENSMODG00000008529
UniProt: F7DHD9
LinkDB All DBs
Position
4
AA seq 594 aa AA seqDB search
MASSAPSSSSSSSNPGPDSNPTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRIVSAFKERQSSKNLISCENSEREARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIVGWS
NKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTENVILIKCNERGKIIPADLEEKILEAKKKGYVPLYVNATAGTTVYGAFDPIAEIA
DICHKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILIRE
KGILQGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQV
NKCLDLAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSDDRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcggcaccttcctcctcctcctcctcttccaaccctggcccggactccaac
cccaccaacctgcgtcctacgacttatgacacctggtgtggggtggcccacggatgcacc
agaaaattgggactcaagatttgcggcttcttacaaaggaccaacagcctggaggagaag
agtcggattgtgagtgccttcaaggaaaggcaatcctcaaagaatctaatatcatgtgag
aacagtgagcgagaggcacggttccgccgaactgagactgacttctccaacctgtttgcc
agagacctgcttccagccaagaatggggaagagcaaactgtgcagttccttttggaggtg
gtggatatcctccttaactatgtgaggaagacttttgacagatcaaccaaggtgctggac
ttccaccacccacaccagttgctggagggaatggagggcttcaacctagagctatctgac
caccctgagtccttggagcagattctcgtggactgcagagatactctgaagtatggagtt
cgaacaggtcatcctcgatttttcaaccaactttctactggactggatattattggctta
gccggtgagtggctgacatcaactgccaataccaatatgtttacatatgaaattgcccca
gtgtttgtcctcatggagcaaataacccttaggaagatgcgagagattgttggatggtca
aataaagatggcgatggcatattttctccagggggtgccatatccaatatgtacagcatc
atggctgctcgatataaatacttcccagaagtcaaaaccaaaggcatggctgctgttccc
aaactggtcctctttacctcagaacatagtcactattcaataaagaaggcaggggctgca
cttggctttggaacagaaaatgtgattctgataaaatgcaatgaaagggggaaaatcatc
ccagctgatttggaggaaaaaattcttgaagccaagaaaaagggatatgttcctctttat
gtcaacgcaactgcaggcacaactgtatatggagcttttgatccgattgctgagattgca
gatatatgtcacaaatataacctttggttgcatgttgatgctgcctggggaggaggtctc
cttatgtcccggaagcaccgtcataagctcaatggcatagaaagagccaactcagttacc
tggaaccctcacaagatgatgggcgttctgttgcaatgctctgccattctcattcgggaa
aagggcatactccaaggatgcaatcagatgtgtgctggatacctattccaacaagataag
cagtatgacatttcctatgacactggagacaaggccatacaatgtggccgccatgtggac
attttcaagttttggttgatgtggaaagctaagggcacagtgggattcgaaaatcaggtc
aataagtgcctggatttggcagagtatctctatgccaaaattaaaaacagagaagaattt
gaaatggtttttgatggcgagcctgaacacacaaatgtttgcttctggtacattccacaa
agcctcaggggcatcccagacagtgatgacagacgagaaaaacttcacaaggtggcaccg
aagatcaaagctctgatgatggaatctggtacaactatggttggatatcagcctcaggga
gacaaagccaacttcttccgaatggttatctcaaatccagcagccaccaagtctgacatt
gacttccttattgaggaaatagaaagattggggcaagatctgtaa

DBGET integrated database retrieval system