KEGG   Monodelphis domestica (opossum): 100018159
Entry
100018159         CDS       T01031                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04060  Cytokine-cytokine receptor interaction
mdo04066  HIF-1 signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04630  JAK-STAT signaling pathway
mdo04640  Hematopoietic cell lineage
mdo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100018159 (EPO)
   04066 HIF-1 signaling pathway
    100018159 (EPO)
   04151 PI3K-Akt signaling pathway
    100018159 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100018159 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100018159 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100018159 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mdo04052]
    100018159 (EPO)
Cytokines and growth factors [BR:mdo04052]
 Cytokines
  CSF and other factors
   100018159 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100018159
NCBI-ProteinID: XP_007483424
LinkDB
Position
2
AA seq 162 aa
MEMGVHELLVLLQLLLLRLGDPVRGSPQSPFCDSHILERYILEAKEAQNATVGQKAGEVW
QGLTLLSEAVLKGQALLANSSQTPAALKLFVDKAVSSLRSLRFLLRGLRTQEETVSLPDA
PTAAPFRTFTVGTMDKLFRIYSNFLRGKLKLFLREACQSEER
NT seq 489 nt   +upstreamnt  +downstreamnt
atggagatgggggttcatgaactccttgttctgctgcagctgctgctacttcgccttgga
gatccagtaagaggctctccacagtccccgttttgtgatagccacatcttggaaaggtac
atccttgaggccaaagaagcccagaatgctacggtggggcagaaggcaggagaggtctgg
caggggttgactctgctctctgaagctgtcctaaaggggcaggccttgctggccaactcc
tcccagacaccagcagctctaaagctctttgtggacaaagcagtcagcagcttgagaagt
ctcagattcctgcttcgaggactgagaacacaggaggaaactgtctcccttccagatgcc
ccaacagcagctccatttcgtaccttcactgttgggaccatggacaaactttttcgaatc
tactccaatttcctaaggggaaaactcaagctatttttgagagaagcttgccaaagtgag
gagaggtga

DBGET integrated database retrieval system