KEGG   Monodelphis domestica (opossum): 100018703Help
Entry
100018703         CDS       T01031                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04068  FoxO signaling pathway
mdo04110  Cell cycle
mdo04144  Endocytosis
mdo04218  Cellular senescence
mdo04350  TGF-beta signaling pathway
mdo04371  Apelin signaling pathway
mdo04390  Hippo signaling pathway
mdo04520  Adherens junction
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04659  Th17 cell differentiation
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05161  Hepatitis B
mdo05166  Human T-cell leukemia virus 1 infection
mdo05200  Pathways in cancer
mdo05210  Colorectal cancer
mdo05212  Pancreatic cancer
mdo05220  Chronic myeloid leukemia
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100018703 (SMAD3)
   04390 Hippo signaling pathway
    100018703 (SMAD3)
   04371 Apelin signaling pathway
    100018703 (SMAD3)
   04068 FoxO signaling pathway
    100018703 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100018703 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100018703 (SMAD3)
   04218 Cellular senescence
    100018703 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100018703 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100018703 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100018703 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100018703 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100018703 (SMAD3)
   05212 Pancreatic cancer
    100018703 (SMAD3)
   05225 Hepatocellular carcinoma
    100018703 (SMAD3)
   05226 Gastric cancer
    100018703 (SMAD3)
   05220 Chronic myeloid leukemia
    100018703 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100018703 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100018703 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100018703 (SMAD3)
   05161 Hepatitis B
    100018703 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 100018703
NCBI-ProteinID: XP_007479669
Ensembl: ENSMODG00000009609
LinkDB All DBs
Position
1
AA seq 426 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNI
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEMCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNYIPET
PPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYE
LNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYI
GGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQG
FEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSI
RCSSVS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaaa
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaaaagcctggtcaag
aagcttaagaagaccgggcagttggatgagctggagaaggcgatcaccacgcagaacatc
aacaccaaatgcatcactatccccagatctttggatggtcggctgcaagtatctcaccgg
aaaggactgccccatgtgatctactgccgcctctggagatggccagaccttcacagccac
catgagctccgggccatggagatgtgtgaatttgccttcaacatgaagaaggatgaagtc
tgtgtgaatccctatcattaccagagagtagaaaccccagttctacctcctgtgttggtc
ccaagacacacagagatcccagccgagttccctccgttagatgactacagccattccatt
ccggagaatactaacttccctgcagggatcgaacctcaaagcaattacattccagaaacc
ccaccccctggttacctgagcgaggatggagaaaccagtgatcatcagatgaaccacagc
atggatgcagggtctccaaacttatctccaaatcctatgtcccccgcacacaataatttg
gatctgcagcccgttacttactgcgagccagccttctggtgttccatctcctactatgag
ctgaaccagagggtgggagaaactttccatgcctctcagccttccatgacagtggatggc
ttcactgacccatccaactcggagcgcttctgcctgggtttattgtccaatgtgaacagg
aatgccgccgtggagctcactagacggcacattgggagaggagtacgtctctattacatt
ggaggggaggtctttgcagaatgcctcagcgatagtgccatttttgtccagtcccctaac
tgtaatcagcgctatggctggcacccagcaaccgtctgcaagattccaccaggatgtaac
ctgaagatattcaacaaccaggagtttgcagccctgttggctcagtctgtcaaccagggc
ttcgaggctgtttaccagctgactcggatgtgtacgattcgcatgagctttgtcaaaggc
tggggagcagaatacaggagacagactgtgaccagcaccccctgctggattgaattgcat
ctgaatggtcctctccagtggctggataaggtcctcacccagatgggctctcctagcatc
cgatgctctagtgtatcttag

DBGET integrated database retrieval system