KEGG   Monodelphis domestica (opossum): 100018936Help
Entry
100018936         CDS       T01031                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo05034  Alcoholism
mdo05165  Human papillomavirus infection
mdo05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100018936 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    100018936 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100018936 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:mdo01009]
    100018936 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:mdo03019]
    100018936 (HDAC6)
   04131 Membrane trafficking [BR:mdo04131]
    100018936 (HDAC6)
   03036 Chromosome and associated proteins [BR:mdo03036]
    100018936 (HDAC6)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100018936 (HDAC6)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100018936 (HDAC6)
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100018936 (HDAC6)
Membrane trafficking [BR:mdo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100018936 (HDAC6)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100018936 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100018936
NCBI-ProteinID: XP_007507737
Ensembl: ENSMODG00000010166
LinkDB All DBs
Position
X
AA seq 1069 aa AA seqDB search
MASPVEKPGPSHRSSSPTRPPSASSSRMMGQKRGVRKGSPIPRASPSLADVRRRGRAKKL
SQVSELDLVTDLQDLDLEAGAAVPSGTGLVLDERMSSFHCPWDESFPERPERLQAVQEQL
ARDCLLERCLLIEAQPATPEELQLVHSQEYVDLMASTPQMTESERRALSDTYDSVYLHPN
SFPCALLATGALLRLVDALMTGEIRNGLAVVRPPGHHAQRESMNGYCMFNNIAIAARYAQ
ERHHVARILIVDWDVHHGQGTQFIFEQDPSVLCFSVHRYELGRFWPHLEASDWRATGHGK
GQGYTVNVPWNQVGMRDGDYITAFLHVLLPIALEFQPQMVLVAAGFDAMLGDPKGEMAAT
PGGFAHLTHLLMGLAKGRLILSLEGGYNLHSLALGVSATLQTLLGDPCPMLATPCAPCPS
ALASLSSTLAAHRPFWKVIQRFQSTSEDKEDEYRGVSLGPPPILESLGKSLEQALSLPPS
RTGLVYDEKMMEHFNMWDSHHPERPERIAQIAQHHMELGLTPRCFVLPARSATNQELLAC
HSEEYIERIRATSGLKPRDLHREGTSYNSIYISPHSFCCAQLAAGAACRLVEAILAREVQ
NGLAIVRPPGHHAERDAACGFCFFNSVAVAARHAQEVAGRALRILIVDWDIHHGNGTQHI
FEEDPSVLYVSLHRYDHGAFFPMAEDGASSHVGRGQGEGFNVNVAWNGPRLGDPDYLTAM
HHIVMPIAYEFNPELVLVSAGFDAARGDPLGGCLVSPEGYAHMTHLLMGLAGGRIALVLE
GGYNLTSISESMAACTRTLLGDPPPLMPWLRPPLPGTFLSLAEVAHIHQKYWQSLRLNAV
ETEAEVEEKEIPPEPAKESTPGQKLPDQRPSKALAIGPELEKQPLSPGLDETLGLESLQL
STCAPEELEAEPSIAKEKHPEDPGLLGEAAGGGGQAAATLLNVLGDQSEDEGATFYAVTP
LPWCPHLVTVRPVPEGGLDVTQPCQGCDTHVENWLCLSCYQVHCGRYVGAHMLQHHEASG
HPLVLSYADLSAWCYICQAYVNHEVLLEAKKTAYQAKFGEEMPTFPRQD
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggcatccccagtggagaagccaggcccgagtcatcgaagcagtagcccaacccgccca
ccatctgcgtccagcagcagaatgatggggcaaaagcgaggagtccggaaaggatcgccc
atccctcgggccagcccaagtttagctgatgtccgacgaagagggagggcaaagaaattg
agtcaagtgtcagagctagatctggtgactgacctgcaggacctggaccttgaggcaggg
gcagcagtaccttcagggactggtctggtgctggatgagagaatgagcagtttccactgc
ccctgggatgagagtttcccagaaaggccagaacgccttcaggccgtgcaggaacaacta
gccagggactgtctgctggagcggtgcttgctcattgaggcccagccagccactcctgag
gaactgcagctggtccatagtcaagaatatgtggacttgatggcatccacaccccagatg
actgaaagcgaacgtcgggccctctcagacacctatgattctgtctacctgcatccgaac
tcattcccttgtgccctcctggctactggggcgctgcttcggctggtggatgctctgatg
acaggcgagatccgaaatgggctagctgttgtcaggccccctggacaccatgcccagcga
gagagcatgaacggctactgcatgttcaacaacattgccatagctgcccgctatgcccaa
gaaaggcaccatgtagcacggatactcattgtggattgggatgttcaccacggtcaaggc
acccagttcatctttgagcaggaccccagtgtcctttgcttctccgttcaccgctatgag
ctgggccgattctggccccatctagaagcatctgactggcgggcaacaggccacggcaag
ggtcagggatacactgtcaacgtgccttggaaccaggtggggatgagggatggggattac
atcaccgccttcctccatgtgctgctccccattgctctggagtttcagcctcagatggtt
ctggtggccgctggcttcgatgccatgctgggtgaccccaagggagagatggcagccact
ccagggggctttgctcacctcactcacttgctcatgggtctggccaaggggaggctgatt
ctgtctctggagggtggctacaatctgcactcccttgctctgggggtcagtgccactctc
cagaccctcctgggagacccatgtcccatgctggcaacaccgtgcgccccctgccccagt
gccctggcttccttgtcctctaccctggctgctcacagacctttctggaaggtcatacag
aggtttcagtctacctctgaggacaaggaggacgagtacaggggagtgagcctgggccct
cccccaattctcgagtccctggggaaatctttagagcaggccctgtctctgcctccaagc
cgaacaggcttggtgtatgatgagaagatgatggagcatttcaacatgtgggacagccac
cacccagagcggcccgagcgcattgcccaaatcgcccagcaccacatggagctggggctg
acccctcgatgtttcgtgttgcctgcccgctctgctacaaaccaggagctgctggcttgc
cacagtgaggagtacattgagcgtattcgggccacgagcgggctgaaacctcgggaccta
caccgtgagggcaccagttacaactccatctatatctccccccactccttctgctgcgcc
cagcttgctgccggagctgcctgccgtttggtggaggccatcttggctagggaggtgcag
aatgggctggccattgtccgcccaccaggccaccatgctgaaagagatgctgcctgcggt
ttctgcttcttcaactctgtggcggtggctgctcggcacgctcaggaggtggcaggccgg
gccctcagaatcctgattgtggactgggacattcaccatggcaatggaacccagcacata
tttgaagaggaccccagtgtgctgtacgtgtccctgcaccgctatgatcatggtgccttc
ttccccatggctgaggacggtgctagcagccatgtgggccgaggccagggagagggcttc
aatgtcaatgtggcatggaatgggccccgccttggagatcctgactatctcaccgccatg
caccatattgtgatgcccatcgcctacgagttcaaccctgagctggtgctggtatctgct
ggctttgatgctgctcggggggacccactagggggctgcctggtttccccagagggctat
gcccatatgactcacctgctgatgggactggctggtggccgcattgccctggtccttgag
ggtggctacaacctgacctccatctcagaatccatggctgcttgcacccggacccttcta
ggtgacccacccccactgatgccctggcttcggcctccgctgcctggaaccttcctctca
ctggctgaggttgcccacatccaccagaagtattggcaaagcttgcggcttaatgcagta
gagacagaagcggaggtggaagaaaaggagataccaccagagccagcaaaggagagtacc
ccggggcagaagcttcctgaccagaggccctcaaaggctttggccataggaccagagcta
gagaaacagcccctgtcacctgggcttgacgagaccttgggcctggagtcccttcaactc
agcacgtgtgctccagaggagctggaggctgagccctccattgccaaagaaaagcacccc
gaggatcctggcctcctcggggaggcagctggtggagggggccaggctgctgccacattg
ctgaatgtcctaggggaccaatctgaggatgagggggccacattctatgctgtgaccccg
ctaccctggtgcccacacctggtgactgtgcgcccagtgcctgaggggggcctggatgtg
acccagccatgccagggctgtgacacccatgtggagaactggctctgcctgtcttgctat
caggttcattgtggccgctatgtgggagctcacatgctgcagcatcatgaggcctcgggc
caccccctggtcctaagctatgctgacctctcagcctggtgttacatctgccaggcctac
gtgaaccatgaggttctgctggaggccaagaaaacagcgtaccaggccaagtttggggag
gagatgccaacgttcccgagacaggactga

DBGET integrated database retrieval system