KEGG   Monodelphis domestica (opossum): 100019959Help
Entry
100019959         CDS       T01031                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdo01002]
    100019959 (TMPRSS9)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100019959 (TMPRSS9)
Peptidases [BR:mdo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100019959 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 100019959
NCBI-ProteinID: XP_003340796
Ensembl: ENSMODG00000004782
LinkDB All DBs
Position
3
AA seq 1139 aa AA seqDB search
MEAAVANLDPTPSNTKAQLAVDTSCWKVTVATVLASAIAVIFLGLLLASLYTQDLSFEHS
AELKGILYDSSLQQETSSYYRALTPALERLFVSSFQKTKLEENCVGCTVLSYRDGNSSVL
VRFRLHFVSQTLWSLTSGLEEETLRQGLAMRFREHSIPLPTYGTIYSAALTGEPWXAGPE
RLXAQGRCPGNAFACQSNQCVSKVNPECDGKVDCSDGSDEAHCDCGGRPALKSANRIVGG
MEAARGEFPWQVSLRENNEHFCGAAILGAKWLVSAAHCFNEFQDPTVWMAYAGTTFLSGS
DSGTVKARVAQIIKHPFYNSDTADFDVAVLELGSPLPFTSHIQPVCLPSATHVFPPRKKC
LISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYSNALTDRMVCAGYLDGKVDSCQGD
SGGPLVCDEPSGRFFLAGIVSWGIGCAEARRPGVYVRVTRVRDWILETISTAPTVSAPAV
FSDSTTSSNWLLMTEKLVTSTTTKPKMVTELDGASLYPGTTARPQECGGRPGMLKPNKIV
GGFDAARGEVPWQVSLKEGSRHFCGATVVGERWLVSAAHCFNHTKMDFVKAYVGTTSLTG
ADGSAVKVSIKSVVLHPSYNPVILDFDVAVLELASPLLFNKYIQPVCLPLTIQKFPVGQK
CMISGWGNTHEGNATKPEILQKASVGIIDQKTCSVLYNFSLTDRMICAGFLEGKIDSCQG
DSGGPLACEETPGVFYLAGVVSWGIGCAQAKKPGVYSRMTRLKDWIVDTISPGLQTSSTL
SPEKTPLVTSQALGATSSTTTTRVTTSKLTPPPTSKTTPKPTSITTLKTTSQPTSQPTSR
TTSRPTTSKTTPRPTSETTTRRPTSVVITTIRTTSSKPPPSPQTHRPATPIPLPDCGISP
VGTLTKIVGGSAASRGEWPWQVSLWLRRKEHKCGAVLIADRWLLTAAHCFDVYSDPNMWV
AFLGTASLSGVDGKVEKVYRIYKHPFYNVYTLDYDVALLELSAPVRYTSVIKPICLPDHS
HLFAEGTKCFITGWGSIREGGMMARHLQKAVVNIIGEETCRKFYPIQISNRMLCAGFAQG
GVDSCSGDAGGPLACKEPAGRWFLAGVTSWGYGCARPYFPGVYSKVTAVRGWIRQNIRL
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagccgttgccaacttggatcccacgcctagtaatacaaaagcccagctggct
gtggacacttcctgctggaaggtgactgtggccaccgtcctagccagtgccattgctgtc
attttcttaggactccttctggcctccctctacacacaggacctcagttttgagcactca
gctgaactgaaaggaatcttatatgacagcagcctgcagcaggagacctcgagctattat
cgggctttgactccagctctggaaaggctgtttgtaagtagttttcagaagacaaagtta
gaagagaattgtgttggctgcaccgttctgagttacagggatgggaactccagtgtgctg
gtccgtttccgtctacactttgtgtcccaaaccctctggtccctgacctctggactggag
gaggaaacactcaggcaaggtctggccatgaggttccgagagcacagcatccctcttccc
acctacgggaccatctattctgctgccctcacaggtgagccatggtaggctggacctgaa
aggctgtaggcccaaggacgttgtccagggaatgcttttgcctgccagagtaaccagtgc
gtatccaaagtgaaccctgaatgtgacggcaaagtggattgttccgatggttctgatgaa
gcccactgtgattgtggaggccgacctgccttgaaatcagccaacaggattgtgggagga
atggaggctgcccggggagagtttccttggcaagtcagccttcgggaaaacaacgaacat
ttctgtggggcagccattctcggtgccaagtggctggtatccgcagctcactgcttcaat
gaattccaggaccccaccgtctggatggcctacgccgggaccacctttctcagcggctcg
gacagcggcaccgtgaaggcccgcgtggcccagatcatcaaacaccccttctacaactcg
gacaccgcagactttgacgtggccgtcctggagctgggcagccccctgcctttcaccagc
cacatccagcccgtgtgcctgccctccgccactcacgtcttccctccccggaagaaatgt
ctcatctccggctggggctaccttaaggaggatttcttggtgaagcccgaggtcctccag
aaggccaccgtggagctgctggaccaggcgctgtgtgcgagcctctacagcaacgcgctc
accgacaggatggtgtgtgccggctacctggacggcaaggtggattcctgtcagggtgat
tcaggaggaccactggtctgcgacgagccctcagggaggttcttccttgctggcattgtg
agctggggcattggctgtgcagaagctcggaggccgggagtctatgtccgtgtgaccagg
gttcgagactggattttggagaccatctccacggcacccactgtcagcgcaccagctgtc
ttttctgactccaccaccagcagtaactggctcttgatgacagagaagcttgtgaccagc
accaccaccaagcccaagatggtcacagaactggatggggcatctctgtatcctggcacc
actgccaggccacaagagtgcggggggagacccgggatgctgaaacccaacaaaatcgtc
gggggattcgacgctgccaggggggaggtcccgtggcaggtcagcctgaaggaggggtct
cggcacttctgcggagccacggtggtgggcgagcgctggctggtgtcggccgctcactgc
ttcaatcacacaaaaatggactttgtgaaagcctatgtggggaccacgtcactgacagga
gcagatggcagcgctgtgaaggtcagcatcaagagtgtggttctgcacccctcctacaat
cctgtcatcctggactttgacgtggctgtgctggagttggccagccccctcctcttcaac
aagtacattcagcccgtctgcctcccactgaccatccagaaattccccgtgggccagaag
tgcatgatatctggatgggggaacacccatgaaggcaacgcaactaagcctgagatcctg
cagaaggcatctgtgggtatcattgatcaaaagacatgtagcgtcctctacaatttctcc
ctcaccgatcgtatgatatgtgctggttttctggaggggaaaatagattcatgtcagggt
gattctggggggccactagcctgtgaagaaactccaggtgttttttacctggcaggggtt
gtgagctggggcattggatgtgctcaagctaaaaagccaggagtgtactcccggatgacc
aggctcaaagactggattgtggacaccatctcacctggcctgcagaccagctctactctc
tcacctgagaaaacccctctcgttaccagccaagccctaggagcaacatcaagcacaaca
accacacgtgtgaccaccagtaaactgaccccaccaccaaccagcaaaaccacccccaaa
cccaccagtataaccaccctcaagaccaccagccaacctaccagtcagcccaccagcagg
actactagcagacccacaactagcaaaactaccccgaggcctaccagtgaaactacaacc
aggagacccaccagtgtggtcattacaacaatcagaaccaccagtagtaagccgccccct
tcaccacaaacccaccgaccagctacacccattccgcttccagactgcggcatctcgcca
gtgggcaccctcaccaagatcgtgggtggcagcgccgccagccgtggggaatggccctgg
caggtcagcctttggctcaggaggaaagaacacaagtgcggggcagtgctgattgcggac
aggtggctgctcactgccgcacactgttttgacgtgtacagtgaccccaatatgtgggtg
gccttcctggggacagcctccctaagcggcgtcgatgggaaggtggagaaggtgtaccgc
atctacaagcaccccttctacaacgtctataccctggactatgatgtggccctcctggaa
ctatcagctcctgtgagatacaccagcgtcatcaaacccatctgcctcccagaccactct
cacctctttgctgaaggaacaaagtgcttcatcactggctggggctccattcgagaagga
gggatgatggccaggcacctgcagaaagctgttgtgaacatcatcggagaagagacctgt
aggaagttctaccccatccagatcagtaaccggatgctgtgtgcgggctttgcccaggga
ggtgtagacagctgctcgggtgatgccgggggaccgctggcttgcaaggagcctgctggg
agatggtttcttgctggggtcacgagctggggctacggctgcgccaggccatacttccct
ggcgtctactccaaggtgacggctgtgaggggctggatcaggcagaacatcagactgtga

DBGET integrated database retrieval system