KEGG   Monodelphis domestica (opossum): 100020636Help
Entry
100020636         CDS       T01031                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100020636 (F13A1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100020636 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100020636
NCBI-ProteinID: XP_001368010
Ensembl: ENSMODG00000009877
LinkDB All DBs
Position
3
AA seq 730 aa AA seqDB search
MSEGTRTTFSGRSALPPNNSNKEEDELPTMEIEGLMPRGVKPQDFLNVTDIHLFKENWDT
NKVDHHTDRYYNEKLIVRRGQPFYIQVDFNRPYDPQNDFFRLEYVIGRYPQESKRTYVPV
PIVSEFQSGKWGAKIILKEDRSVRLSVQSSPNCIVGKFRMYVAIWTPYGIIRTSRNPATD
TYILFNPWCEEDTVYLDNEKEREEYVLNDLGTIFHGNFDDIKTRSWNYGQFEDGILDACL
YLMDRAQMDLSGRGNPVKVSRVASAMINAKDDQGVIVGSWDNIYAYGVPPSAWTGSVDIL
LEYQSSGTPVQYGQCWVFAGVLNTFFRCLGIPSRVITNYFSAHDNNANLQMDIFLDEDGK
INSKLTKDSVWNYHCWNEAWMSRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDTPFVFAEVNSDLVYLKVKKDATHLVEAVDKTHIGKLILTKEIGGDGNQDITE
NYKFQEGKEEERLALETALMYGAKKPLDTEGIHEFKADIDMDFEVEKAILGKDFKVTITF
RNSSSRHYTATAYLSGNIVFYTGVTKSEFKNQTFNVKVEPYSFTNVEVQIKAGEYMGQLL
EQASLHFFVSARINETGKVLALQKSTVLHIPTLNLKVRGHKVVGSDMVVTVEFTNPLAET
LYNISIHLDGPGVMKPIRKKFRELAPNSTLTWEEVCRPWVPGSRKLMATLNCDALRHVYG
ELKLEIQRRP
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggtaccaggactaccttttcgggcaggagcgctctcccacccaacaattcc
aataaagaagaagatgagctccccaccatggagattgagggcctcatgcccaggggagtt
aaaccacaagactttctgaatgtcacagacatccacctcttcaaggaaaactgggacacc
aacaaggtggaccatcacacagatcggtattacaatgaaaagttgatcgtccgccgaggg
cagcctttctacatccaggtggactttaatcgcccttatgatccccaaaatgatttcttc
aggctggaatatgtcattggtcgataccctcaggaaagtaaaaggacctatgttcctgtc
ccaattgtgtcagagtttcaaagtggaaagtggggggcaaagattatcttgaaagaagac
cgatctgtccgcctgtctgtccagtcctccccaaactgcattgtggggaaattccgcatg
tatgttgccatctggacgccttatggcatcatccgaacaagcaggaatccagcaactgac
acttatattctcttcaatccttggtgtgaagaggatactgtgtatctggataatgagaag
gaaagagaagagtatgtcctgaatgaccttgggactattttccatggaaactttgatgac
ataaaaactaggagctggaattatggtcagtttgaagatggtatcctggatgcttgccta
tacttgatggacagagcacaaatggatctctctggacggggcaacccagtgaaagtcagt
cgtgttgcatctgcaatgatcaatgccaaagatgatcaaggtgttattgttggatcttgg
gacaatatatatgcctatggagtgcctccttctgcctggactgggagtgttgacatcctt
ttggaatatcagagttctgggaccccagtacaatatggtcaatgctgggtttttgctggt
gtcctcaacactttttttcggtgccttggaataccttcaagagttatcaccaattatttc
tcagcccatgacaataatgccaatttgcaaatggacatcttcctggatgaagacgggaaa
ataaattccaaacttacaaaggactcagtgtggaactaccattgctggaatgaggcctgg
atgagcagacccgatcttcctgttggttttggaggatggcaagtggtagacagcacacct
caagaaaacagtgatggtatgtaccgctgtggtcctgcctctgttcaggctgttaagcat
ggtcatgtttgtttccagtttgatacaccatttgtttttgcagaggtcaacagtgatctt
gtgtaccttaaagtcaaaaaagatgccactcatctggttgaagctgttgataaaacccac
attgggaaattaatcctgaccaaggaaattggtggagatggaaatcaggacataactgaa
aactataaatttcaagaaggcaaagaagaggagagacttgctctagaaactgctctgatg
tatggggctaaaaaacctcttgacacagagggcattcatgaattcaaggctgatattgat
atggattttgaggtggaaaaggctatacttgggaaagacttcaaagtcaccatcactttc
cggaacagcagctcgagacattacacagccacagcttatctctctggcaatatcgtcttc
tatacaggtgttacaaagtcagaattcaagaatcagaccttcaatgtgaaagtggagccc
tactcctttacaaacgtggaggtgcaaatcaaagctggcgagtacatgggccaactgctg
gaacaggcctcgctccatttcttcgtgtccgctcggatcaatgaaaccggcaaggttctg
gctttgcagaaatcaactgtactgcacatccctacactcaacctcaaggttcgtggacac
aaagtagttggttcagacatggttgtcacggtagaattcaccaacccactcgcagaaacc
ctctacaatatctcgatacaccttgatggacctggagtaatgaaaccaatcaggaaaaag
tttcgggaactcgcacccaattctactttgacatgggaagaagtgtgtcggccctgggtc
cctggctcacgaaaactgatggctaccctgaactgcgatgccttgagacacgtgtatgga
gagcttaagctagagattcaacggaggccatag

DBGET integrated database retrieval system